(data stored in ACNUC6288 zone)

EMBL: CR382138.PE48

CR382138.PE48        Location/Qualifiers
FT   CDS_pept        109654..110481
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01210g"
FT                   /old_locus_tag="DEHA0F01419g"
FT                   /old_locus_tag="DEHA-IPF9006"
FT                   /old_locus_tag="DEHA-CDS4293.1"
FT                   /product="DEHA2F01210p"
FT                   /note="similar to uniprot|P32787 Saccharomyces cerevisiae
FT                   YJR144W MGM101 Protein involved in mitochondrial genome
FT                   maintenance"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88719"
FT                   /db_xref="GOA:Q6BN05"
FT                   /db_xref="InterPro:IPR009446"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BN05"
FT                   /protein_id="CAG88719.2"
FT                   /translation="MIRGTSLSTSSRSIKVFIFNARYSSNYVKAPIKKMSYNSAFQKSY
FT                   YSNPASKNGMTNNSATTSSPKPISNNESESSSSSSTIKSFSDSPAIASSPEVGSPINWS
FT                   DSFHGLGTAPFPKEVSDILLASIDNDDIEIKPDGLLYLPEIKYRRILNRAFGPGGWGLA
FT                   PRTESLITPKQISREYALICHGRLVSVARGEQDYFGGDEKITTALEGCKSNALMRCCKD
FT                   LGIASELWDPSFIRKWKKDFCDEIFAEHVTTKKKKKLWKLKKNKTLDYPYKKI"
     atgatacgtg ggacatcctt atctacatca agtaggtcaa taaaagtgtt tatttttaat        60
     gctagatata gcagcaacta tgtcaaagca cccattaaga agatgtcgta taattcagct       120
     tttcagaaat cttactattc aaaccctgct tcaaagaatg gtatgacaaa taattctgct       180
     acaacatcta gtcccaaacc tatcctgaat aatgaatctg aatcatcatc ctccagtagt       240
     acgattaagt cgtttagtga ttcaccagct atcgcaagct caccagaagt tggttcacct       300
     atcaattggt cagattcttt tcatggtcta ggtacagctc cattcccaaa ggaggtaagt       360
     gacatactat tggcatctat agataatgat gatattgaaa tcaagccgga tgggctttta       420
     taccttccag agattaagta tcgtagaatc ttaaataggg cattcggacc tggaggttgg       480
     gggttagctc cacgtaccga atccttgatt actccgaagc aaatatctcg tgaatatgcg       540
     ttgatttgtc acggaaggct agttagcgtt gccagaggcg aacaagatta ttttggtggg       600
     gatgaaaaga taactacagc attggaaggc tgtaagagta atgcattgat gagatgttgt       660
     aaagatttag ggatcgcaag cgaattatgg gatcccagct ttattagaaa gtggaagaag       720
     gacttttgtg atgaaatatt tgccgagcat gtcactacta agaagaagaa gaaattatgg       780
     aagttaaaga agaataaaac attagactac ccatacaaga aaatatga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page