(data stored in ACNUC6288 zone)

EMBL: CR382138.PE52

CR382138.PE52        Location/Qualifiers
FT   CDS_pept        114400..115482
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01298g"
FT                   /old_locus_tag="DEHA0F01507g"
FT                   /old_locus_tag="DEHA-IPF9001"
FT                   /old_locus_tag="DEHA-CDS3578.1"
FT                   /product="DEHA2F01298p"
FT                   /note="similar to uniprot|P31116 Saccharomyces cerevisiae
FT                   YJR139C HOM6 Homoserine dehydrogenase (L-homoserine:NADP
FT                   oxidoreductase) dimeric enzyme that catalyzes the third
FT                   step in the common pathway for methionine and threonine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88723"
FT                   /db_xref="GOA:Q6BN01"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN01"
FT                   /protein_id="CAG88723.1"
FT                   /translation="MVKSVNVAIIGSGVVGSAFVNQLKNLKTAINFNVVYFARSSKEAL
FT                   FSSDYKPVDLASYKNASAQAVLSLDELTKFLKGASKPTILIDNTSNSTIADYYPTFVKE
FT                   GISIATPNKKAFSSDLSVWNEIFKNSEAPSGGLVYHEATVGAGLPIIGPLRDLITTGDK
FT                   VEKIEGIFSGTLSYIFNEFSTTDPSTKVKFSDVVKVAKDLGYTEPDPRDDLNGLDVARK
FT                   VTILARISGFDVESPTSFPVESLIPKELESVQTADEFLSKLPDFDADIQKVKEEALAEN
FT                   KVLRFVGQVDFKANKVSVEIGKYGFDHPFASLKGSDNVVSIKTERYSNPLIIQGAGAGA
FT                   EVTAHGVLADAIKIAERIAI"
     atggtcaaat ctgtcaatgt tgctattatt ggttcgggtg ttgttggttc agcatttgtt        60
     aatcaattaa aaaacttaaa aactgctatt aacttcaatg ttgtctactt tgctagatct       120
     tctaaagaag cattattctc ttctgactat aaacctgttg acttagcttc ttacaagaat       180
     gcttcggcgc aggctgtttt atcattggac gagttgacga agtttttgaa aggtgcttcc       240
     aagccaacta tcttaattga taacacctca aatagtacta tagctgatta ctaccctaca       300
     tttgttaaag aaggtatctc tattgctact ccaaataaga aggctttttc gtctgattta       360
     tcagtctgga atgaaatctt caagaactct gaggctcctt ccggtggttt ggtttatcat       420
     gaagctaccg ttggtgctgg attgccaatt atcggtcctt tgagagattt gattactact       480
     ggcgataaag ttgaaaaaat cgaaggtatc ttctctggta cattatcata tattttcaac       540
     gaattttcta ccactgatcc ttctactaag gtaaagttct cagatgtagt caaagttgcc       600
     aaggacttgg gttacactga gcctgatcca agagatgatt tgaacggttt agatgttgct       660
     agaaaggtca ccattttagc tagaatatca ggctttgatg ttgaatctcc aacttctttc       720
     cctgttgagt ctcttattcc aaaggagtta gaaagtgttc aaactgctga tgaattttta       780
     tcaaaattac cagattttga tgctgatatc caaaaggtta aagaagaagc gttagctgaa       840
     aataaggttt taaggttcgt cggtcaagtt gattttaagg ctaataaagt ttctgtagaa       900
     atcggtaaat acgggttcga ccatccattt gcttccttga agggtagcga taacgtcgta       960
     tcaattaaaa ccgaaagata ttcgaaccca ttaattatcc aaggtgctgg tgctggtgca      1020
     gaagttacag cacacggtgt tttggctgat gcgattaaga tcgctgaaag aatagctatt      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page