(data stored in ACNUC6288 zone)

EMBL: CR382138.PE55

CR382138.PE55        Location/Qualifiers
FT   CDS_pept        121660..122544
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01364g"
FT                   /old_locus_tag="DEHA0F01573g"
FT                   /old_locus_tag="DEHA-IPF8997"
FT                   /old_locus_tag="DEHA-CDS4298.1"
FT                   /product="DEHA2F01364p"
FT                   /note="highly similar to uniprot|Q03148 Saccharomyces
FT                   cerevisiae YMR096W SNZ1 Protein involved in vitamin B6
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88726"
FT                   /db_xref="GOA:Q6BMZ8"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMZ8"
FT                   /protein_id="CAG88726.1"
FT                   /translation="MTQEFKVKAGLAQMLKGGVIMDVVTPEQAKIAEKAGACAVMALER
FT                   IPADMRASGQVCRMSDPKMIKEIMATVSIPVMAKCRIGHFVEAQILEALEVDYIDESEV
FT                   LTPADKLYHIKKDQFKVPFVCGARNLGEALRRVSEGAAMLRTKGEAGTGDISEAVSHIN
FT                   LIKQQIDHALSLKSEAEVAAYAEELRVPLITLQELIANKGKFPVVNFAAGGVATPADAA
FT                   LCMQLGCDGVFVGSGIFKSKNPELLAKAIVNAVTHYDDPKKVMEYSTDLGELMFGVSVD
FT                   SLKASEKVSTRGW"
     atgacacaag aattcaaagt taaagctgga ttagcacaaa tgttaaaggg tggtgttatc        60
     atggatgtgg ttactccaga acaggccaaa attgctgaaa aggccggtgc atgtgccgtt       120
     atggccttgg aaagaatccc agccgatatg agagcatcgg gacaagtatg tcgtatgtca       180
     gatccaaaaa tgatcaagga gattatggca acagtttcaa ttccggttat ggcaaaatgt       240
     agaatcggac actttgttga agctcagatt ttggaagcat tggaagttga ttacattgac       300
     gagtctgaag tgttgacccc agcagacaaa ttgtaccata tcaaaaaaga tcaattcaaa       360
     gttccatttg tatgtggcgc aagaaactta ggcgaagcct tgagaagagt cagtgaaggt       420
     gcagccatgt tgagaaccaa aggagaagct ggtacaggcg atatttcaga agctgtgagc       480
     catatcaact tgatcaaaca acaaatcgat catgctttat ctttgaagtc tgaagccgag       540
     gtcgccgcgt acgcggaaga attgagagtt cctcttataa cattgcaaga attaatcgcc       600
     aacaaaggaa agttcccagt tgtcaatttt gctgccggtg gtgttgccac tcctgctgat       660
     gctgctttat gtatgcaatt gggatgtgac ggtgtttttg tcggttcagg tattttcaaa       720
     tccaagaatc ccgaactttt agccaaggcg attgtgaatg cggtcaccca ttatgacgat       780
     ccaaagaaag ttatggaata ctctaccgac ttaggtgaat tgatgtttgg tgtcagtgtt       840
     gactctttaa aggccagtga gaaggtatct acaagaggat ggtag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page