(data stored in ACNUC6288 zone)

EMBL: CR382138.PE64

CR382138.PE64        Location/Qualifiers
FT   CDS_pept        complement(139137..139496)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01562g"
FT                   /old_locus_tag="DEHA0F01826g"
FT                   /old_locus_tag="DEHA-IPF8981"
FT                   /old_locus_tag="DEHA-CDS6767.1"
FT                   /product="DEHA2F01562p"
FT                   /note="similar to uniprot|Q06835 Saccharomyces cerevisiae
FT                   YPR094w RDS3 Well-conserved 12-kDa protein with five CxxC
FT                   zinc fingers that has been implicated in the activation of
FT                   certain drug transport genes and in the pre-mRNA splicing
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88738"
FT                   /db_xref="GOA:Q6BMY9"
FT                   /db_xref="InterPro:IPR005345"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY9"
FT                   /protein_id="CAG88738.2"
FT                   /translation="MSRHQYDLIQCMKQPGTHMGMLCQSCDGKCPICDSFVKPTTKVRI
FT                   CDECSFGHLGNKCILCGNNLGVNKELGSAAYYCLECVRLEKDREGCPRIVNVGSSKADM
FT                   IQNKKKANATGGLLQ"
     atgtcacgtc atcaatatga tttgatacaa tgtatgaaac agccgggaac tcatatgggc        60
     atgctttgtc aactgtgtga tggtaaatgt ccaatttgcg attctttcgt taagccgact       120
     actaaagttc gtatttgcga tgagtgttca tttggtcatc taggtaataa gtgtatactc       180
     tgtggaaaca accttggggt aaataaagaa ttaggatctg ctgcatatta ctgtttagaa       240
     tgtgtacgat tggaaaagga tagggaaggt tgcccacgca ttgttaatgt gggtagttca       300
     aaggctgata tgatacagaa taagaagaag gcaaacgcaa ctggaggctt actacaataa       360
//

If you have problems or comments...

PBIL Back to PBIL home page