(data stored in ACNUC6288 zone)

EMBL: CR382138.PE65

CR382138.PE65        Location/Qualifiers
FT   CDS_pept        139662..141353
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01584g"
FT                   /old_locus_tag="DEHA0F01848g"
FT                   /old_locus_tag="DEHA-IPF8980"
FT                   /old_locus_tag="DEHA-CDS1864.1"
FT                   /product="DEHA2F01584p"
FT                   /note="weakly similar to uniprot|Q06834 Saccharomyces
FT                   cerevisiae YPR093C ASR1 Protein involved in a putative
FT                   alcohol-responsive signaling pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88739"
FT                   /db_xref="GOA:Q6BMY8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY8"
FT                   /protein_id="CAG88739.2"
FT                   /translation="MSLAIKEEECTICLEVITFASTIGTIKNCHHYYHEDCILQWSSHS
FT                   NSCPTCRKLFYKIDVSRHDEPNKIRKSISIRDKLLPNDAIDQIPQEYIIPMNSPSTDRE
FT                   NSHSTLDQITEHYSSNNKLCSICSSSDYRSSLSRNLIYCNNCPSAFHLNCLGVNAYEEF
FT                   DDLTWCCPMCDSLQDLSAMPTYQSGVSNRSRSSRGAGNIRPRANRIRTPRTTTSTSSLN
FT                   SHITDAIFRNASVPINVVPRVDNLNVTSERISRENSKRRPGLIIHNENGELDDDFLYDN
FT                   SNPEDETNIRAENNRVYSPPIINGGVILRKELKEKQKLSKEEARSWDVFDEARKCKVDS
FT                   ESSNAVKSIAQKTEEPRARRRRKKLSDLPHPNPNPELIEGTSANLQNVSEKKQEKTRIS
FT                   SLISQLRSQQTGCKYERNVITTSTTPEISTGISLNPTESISGDSGASSDSETKSQRKKA
FT                   CIDKPTSMELSLEQKVEIQKHIRNNLRPLYRPGDSNPSCSPMIRSEEIYIEINKSASRK
FT                   IYAHILSLITSETDESKCIEYFNDDETKLKSIVEKFVRDELRYYKW"
     atgagccttg ccataaagga agaggaatgt acaatttgtt tggaagttat cacatttgcc        60
     agtactatag gtacaataaa aaattgccac cattattatc atgaagattg cattctacag       120
     tggtcctctc attcaaattc ttgtcctaca tgccgaaaat tgttttataa gatagatgtt       180
     tcaaggcatg acgaacctaa taaaatacgg aaactgatat caataagaga taagttattg       240
     ccgaatgacg ccatagatca aatcccacag gagtacatca tacccatgaa ttctccgtct       300
     acagatagag aaaatagtca cagtacgcta gatcaaataa cggaacatta ttccagtaac       360
     aataaacttt gttctatttg ctcaagttct gattacagaa gttcgttatc aagaaatctt       420
     atctattgca ataactgccc atcggcattt catttaaatt gcttaggtgt aaatgcatat       480
     gaagagttcg atgatcttac ttggtgttgc ccaatgtgtg atagccttca agatttatcg       540
     gccatgccta catatcaatc gggtgtatca aatagaagca ggtcatcgag aggtgcaggt       600
     aacatacgac ctagggcaaa caggataaga acaccaagga caacgacatc gacatcgctg       660
     ttaaactctc acataacgga tgcaatattt aggaatgctt ctgtgcccat taatgttgta       720
     cctagagtag ataatcttaa tgttaccctg gaacgtatat cgagggaaaa ttcaaaacga       780
     agaccaggat tgattataca caatgaaaat ggcgaattag atgatgattt cctatatgat       840
     aatagcaacc ctgaagacga gactaatatt agagccgaaa ataatagagt gtattctccg       900
     cctataataa atggtggtgt tatattacgc aaggaattaa aggagaaaca aaagttgtct       960
     aaagaggagg cgcgatcgtg ggatgtattc gatgaagcac gtaagtgtaa ggttgactct      1020
     gaaagttcaa acgcagtgaa atctatagct cagaaaactg aagaaccaag agcaagaagg      1080
     agacggaaaa agctttctga tttacctcac cctaatccta accctgaatt aatagaaggt      1140
     acatcagcaa acttgcaaaa tgtctccgag aagaaacaag aaaaaacaag aatttctagc      1200
     ttaattagcc aacttcgttc acaacagaca ggatgcaaat atgaaagaaa tgtgattacg      1260
     acttctacca cccccgaaat ttccacagga atttcactta atccaactga gtctatttca      1320
     ggagatagtg gggcgctgtc tgacagtgaa actaaatctc aaagaaaaaa ggcttgtatt      1380
     gataagccaa ctagtatgga attatcactc gaacagaagg tggaaattca aaaacatatt      1440
     cgaaataact tgagacctct atatcgccca ggagattcca acccaagttg ttctcccatg      1500
     attaggtctg aggagatata tatcgaaatt aacaagagtg catcgagaaa gatatatgca      1560
     catattttat cgttgattac aagtgagacg gacgaactga aatgtataga atattttaac      1620
     gatgatgaaa caaaattaaa atccatagtt gaaaagttcg ttcgggatga attgagatac      1680
     tacaaatggt aa                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page