(data stored in ACNUC6288 zone)

EMBL: CR382138.PE70

CR382138.PE70        Location/Qualifiers
FT   CDS_pept        complement(148453..149385)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01694g"
FT                   /old_locus_tag="DEHA0F01958g"
FT                   /old_locus_tag="DEHA-IPF8973"
FT                   /old_locus_tag="DEHA-CDS4127.1"
FT                   /product="DEHA2F01694p"
FT                   /note="highly similar to uniprot|P53252 Saccharomyces
FT                   cerevisiae YGR086C PIL1 Long chain base-responsive
FT                   inhibitor of protein kinases Phk1p and Phk2p acts along
FT                   with Lsp1p to down-regulate heat stress resistance via
FT                   regulation of the Pkc1p and Ypk1p pathways"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88744"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR028245"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY3"
FT                   /protein_id="CAG88744.1"
FT                   /translation="MHRTYSLRSSRAPTAAQLQSPPPPTSSTKQKFFGKGSLSHTFRKQ
FT                   AAGSMGPELSRKLAVLVKMEKNLMRSIEITSRERKDVAKQLSIWGEANDEDVSDITDKL
FT                   GVLIYEVGELEDQFIDRYDQYRITIKSIRDIEGSVQPSRDRKQKITDQIAYLKYKDPQS
FT                   PKINVLEQELVRAEAESLVAEAQLSNITREKLKTAFNYQFDSTREHAEKIALIAGYGKA
FT                   LLELLDESPVTPGETRPAYDGYEASKQIIIDAENALASWTFDSAVVRPTLSLATHEHDD
FT                   EYDVDELAEDARNMQVTEKEWEDENRVTA"
     atgcatagaa cttattcttt aagatcctcg agagctccaa ctgctgctca gttacaatcg        60
     ccacctccac caacttcgtc gaccaagcaa aagttttttg gtaaaggttc gctttctcac       120
     actttccgta aacaagctgc tggttctatg ggtccagaat tgagcagaaa attggctgtt       180
     ttagtcaaga tggaaaagaa cttaatgaga tctattgaaa ttacttcaag agaaagaaag       240
     gatgttgcta agcaattatc aatctggggt gaagctaatg acgaagatgt cagtgatatc       300
     actgacaagt taggtgtctt aatatatgaa gttggtgaat tagaagacca attcattgac       360
     agatatgatc aatacagaat caccatcaag tcaattcgtg acattgaagg ttctgtccaa       420
     ccatccagag acagaaagca aaagatcacc gaccaaattg cttacttgaa gtacaaggac       480
     ccacaatcgc caaagattaa tgttttggaa caagaattgg tcagagctga agccgaatct       540
     ttagttgctg aagcccaatt atccaacatt accagagaaa agttgaagac tgctttcaac       600
     taccaatttg actccaccag agaacacgcc gaaaagattg ctcttattgc tggttacggt       660
     aaggccttat tggaattatt ggacgaatcc ccagttacac caggtgaaac cagaccagct       720
     tacgatggtt acgaagcttc taagcaaatc attattgatg ctgaaaacgc tttagcctct       780
     tggacttttg actctgccgt tgtcagacca accttatcgt tagctactca cgaacacgac       840
     gacgaatacg acgttgacga attagctgaa gatgctagaa acatgcaagt cactgaaaag       900
     gaatgggaag acgaaaacag agttactgct tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page