(data stored in ACNUC6288 zone)

EMBL: CR382138.PE72

CR382138.PE72        Location/Qualifiers
FT   CDS_pept        152133..152822
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01738g"
FT                   /old_locus_tag="DEHA0F02002g"
FT                   /old_locus_tag="DEHA-IPF8970"
FT                   /old_locus_tag="DEHA-CDS4759.1"
FT                   /product="DEHA2F01738p"
FT                   /note="weakly similar to uniprot|Q06563 Saccharomyces
FT                   cerevisiae YLR251w SYM1 Protein and similar to
FT                   CA3605|IPF3865 Candida albicans IPF3865 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88746"
FT                   /db_xref="GOA:Q6BMY1"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY1"
FT                   /protein_id="CAG88746.2"
FT                   /translation="MSFFDKYNRLLKTHPFRVNMVTTGLLFGVGDGVAQKLFPSNHDHL
FT                   DEEKPKYNVYRTMRAMIYGSCFFAPCGVLWYGKRLPLIKNPFVSVKNRETWSKNRVHLY
FT                   DTLYRVAIDQIFIPGLFWIPMYNIVMSTLSGYENPLEVAFHKLQHNWWNVLTTNWMVWP
FT                   GFQLISFFYIPVHLRIVAANICSVGWNCFLSYLYNGKAHGDHQKEEILDHLVDPDEEIE
FT                   ETTMVVY"
     atgtcattct ttgataaata caataggcta ttgaaaacac acccttttag ggtgaatatg        60
     gtgacaactg ggctcttatt tggtgtagga gatggagtag cccagaagtt attccccctg       120
     aatcacgatc atcttgacga agaaaaaccg aagtataatg tatacagaac tatgagagct       180
     atgatatatg gttcgtgttt ttttgctccc tgcggtgtat tgtggtatgg gaaaaggcta       240
     ccactaatca aaaatccatt tgtttcggtt aagaatcggg aaacatggag caaaaataga       300
     gtacacttat atgatacgtt atacagggta gcaatcgacc aaatcttcat tcctgggttg       360
     ttttggattc cgatgtacaa tatagtgatg tcgactctta gtggatatga gaatccgttg       420
     gaggtggctt tccataaatt gcaacacaat tggtggaacg tgttgacaac aaactggatg       480
     gtgtggcctg ggtttcagtt aataagtttt ttctatattc cagtgcatct acgtatagtg       540
     gctgccaata tttgttcggt ggggtggaat tgctttttga gctaccttta taatggaaaa       600
     gcacatggtg atcaccaaaa agaagagatt ttagaccatt tggtagatcc tgatgaagaa       660
     atagaggaaa ccacaatggt ggtgtattag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page