(data stored in ACNUC6288 zone)

EMBL: CR382138.PE77

CR382138.PE77        Location/Qualifiers
FT   CDS_pept        160739..161650
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01848g"
FT                   /old_locus_tag="IPF_8961"
FT                   /product="DEHA2F01848p"
FT                   /note="similar to uniprot|P10962 Saccharomyces cerevisiae
FT                   YAL025C MAK16 Essential nuclear protein required for normal
FT                   concentration of free 60S ribosomal subunits"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88751"
FT                   /db_xref="GOA:Q6BMX6"
FT                   /db_xref="InterPro:IPR006958"
FT                   /db_xref="InterPro:IPR029004"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMX6"
FT                   /protein_id="CAG88751.1"
FT                   /translation="MSDEIVWQVINQQFCAFKIKTTKEQNFCRNEYNVSGLCSRQSCPL
FT                   ANSRYATVKNVDGKLYLYMKTAERTHMPSKWWERIRLSKNYNKALSQIDGHLEYWQKFL
FT                   IHKCKQRLTRLTQVAITERRLALREDERHYVGVKHKVKRREENRERKALAAAKIEKAIE
FT                   KELLERLKSGAYGDKPLNVDENIWKKVLGKVDNEEEEEEEDEDDVELESDDESDVGEVE
FT                   YVEDDGDDELVDLEDLEKWLDDSSEESASEESDDESDSEDKSSKRKAAADDKANKRRRR
FT                   PKVEIEYEQEEQEPSIQTNIAA"
     atgtcagacg aaattgtttg gcaagttata aatcagcagt tctgtgcttt caaaattaag        60
     actaccaaag agcaaaactt ttgcagaaat gaatataatg tctcgggttt atgttctcgt       120
     caatcttgtc cattggcaaa ttcaaggtat gctaccgtta agaatgttga tggtaaatta       180
     tacttataca tgaagacagc tgaaagaaca cacatgccat ctaaatggtg ggaaagaatt       240
     agattatcta agaattacaa caaagcattg agccagattg atggccactt ggagtattgg       300
     caaaaatttt tgattcacaa atgcaaacag agattaacca gattaaccca ggttgctatt       360
     actgaaagaa gattagcatt aagagaagat gaaagacatt atgttggtgt taagcataag       420
     gttaagagaa gagaagaaaa tagagaaaga aaggctttag cggcagctaa gattgaaaag       480
     gctatcgaaa aggaattatt agaaagattg aagagtggtg cctatggtga taagccattg       540
     aatgtcgacg aaaacatttg gaagaaggtt ttgggcaaag tcgataatga agaagaagaa       600
     gaggaagaag atgaagacga tgttgaactc gaaagtgacg atgaaagtga tgttggtgaa       660
     gtcgagtatg tggaagatga tggcgacgac gaattggttg acttagaaga tttagaaaaa       720
     tggttggacg attcttctga agaatctgcc tccgaagaat ctgacgacga atcggatagc       780
     gaagataagt cctctaagcg taaagcggct gcagatgata aagcaaacaa gagaaggaga       840
     agacctaagg ttgaaattga atacgaacaa gaagaacaag aaccatcaat ccagaccaac       900
     attgcggctt ag                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page