(data stored in ACNUC6288 zone)

EMBL: CR382138.PE91

CR382138.PE91        Location/Qualifiers
FT   CDS_pept        join(186181..186185,186247..186589)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02156g"
FT                   /product="DEHA2F02156p"
FT                   /note="similar to uniprot|Q06217 Saccharomyces cerevisiae
FT                   YLR275w SMD2 U1 snRNP protein of the Sm class"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88765"
FT                   /db_xref="GOA:Q6BMW2"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027248"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMW2"
FT                   /protein_id="CAG88765.1"
FT                   /translation="MAELIDRPRSELTELELQKLEEFEFTHGPMSLLQNAVNNGSPVVI
FT                   SCRNNHKLIAKVKAFDRHCNLILENVKELWTESVKNNKGKKIKSTSKERFVSKMFLRGD
FT                   SVVIVLKAQAS"
     atggctgaat taatagatcg tcctcgttca gaattaactg aacttgaact tcaaaaattg        60
     gaggagtttg agttcacaca tggacctatg tctttattac agaatgctgt gaataatgga       120
     agccccgttg ttatttcatg tcgtaacaat cataaactta ttgcgaaggt aaaggctttt       180
     gatagacact gtaatttgat attagaaaat gttaaagaat tgtggacaga atccgttaag       240
     aataataagg gcaaaaagat aaagtccacg tctaaagaaa gatttgtatc gaagatgttc       300
     ttgagaggtg attccgttgt tattgtcttg aaggcccagg cttcataa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page