(data stored in ACNUC6288 zone)

EMBL: CR382138.PE98

CR382138.PE98        Location/Qualifiers
FT   CDS_pept        196917..198716
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02354g"
FT                   /old_locus_tag="DEHA0F02640g"
FT                   /old_locus_tag="DEHA-IPF8925"
FT                   /old_locus_tag="DEHA-CDS1708.1"
FT                   /product="DEHA2F02354p"
FT                   /note="weakly similar to uniprot|P38687 Saccharomyces
FT                   cerevisiae YPL243W SRP68 Component of the signal
FT                   recognition particle (SRP) ribonucleoprotein (RNP) complex
FT                   that functions in protein targeting to the endoplasmic
FT                   reticulum (ER) membrane and similar to CA5902|CaSRP68
FT                   Candida albicans CaSRP68"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88773"
FT                   /db_xref="GOA:Q6BMV4"
FT                   /db_xref="InterPro:IPR026258"
FT                   /db_xref="InterPro:IPR034652"
FT                   /db_xref="InterPro:IPR038253"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMV4"
FT                   /protein_id="CAG88773.2"
FT                   /translation="MEYPLIVTLGARMSAYLSSSEDYHKQRKRLNKRLLKLRHELDLIT
FT                   PDTKDYKKKEKISKISSSDYDQDEKYGLLLLLTAERDSLYSSEIKSLLEISNDNASSYR
FT                   NLMISRIKKSLSSSKKLLEITVNEKDEYKRIEYYTYAALIQGNLSVNKKQWSKALNAFS
FT                   IAKCALDFLYSQEDSKMDIEEEQEESTQFKKTLISEITETLVDPSLALAISQDDTAYST
FT                   TTDLKTVSRQHCRDNKLSYLQPVIEIIARIDPEAVSEVSSSTELIKSVQWRDHEATLYN
FT                   DELAYKIMKLTNDNETNWKNFNDANQFDVLLSGWSELLEIHTNDMDKNKDEDDLEKVQD
FT                   RAIVLTYINFNLLFTRLKRDLLIIDQLSSQGDNVFALKKLEFNKDIIRLYGTIITTTQE
FT                   IKDLPGVYNDEDLHESLDNLEKFFVAKKSAVLARSFALNNKFPEALKIFDHVDNTLSSS
FT                   DNKFYKIDEFPYNVSSNVEFEKFKKELPSQVLQAQILAQFSVDLSKNLNQSNFVIENMN
FT                   KYPVSNETLDNIANFNKNLSIAPVLSKPVLFDIGFNYINYGMGRSSSYNNSNSATSTTS
FT                   DSTTDQNDPNKKKSGFFGIFGRS"
     atggaatacc ctcttattgt tacattggga gctcgtatga gcgcatacct ttctagctct        60
     gaagattacc ataagcaaag aaagagacta aataaaaggt tacttaagtt acgtcatgaa       120
     ttggatctta taactccaga taccaaagac tacaagaaga aagaaaaaat atccaaaatc       180
     tcatcttcag attacgacca agacgaaaaa tacgggctac ttttactttt gactgcagaa       240
     agagatagtt tatattcctc agagattaag agtttgttgg aaattagcaa tgacaatgct       300
     tcgtcatata gaaatcttat gataagtaga atcaagaagt cgttatctag ctcaaaaaaa       360
     ttattggaaa tcaccgtaaa tgagaaagat gaatataaaa ggattgaata ttacacctat       420
     gctgccttaa ttcaaggtaa tctatcagtc aataaaaaac aatggtcaaa agcattgaat       480
     gccttctcca tcgctaaatg tgctttagat ttcttatatt ctcaagaaga tagtaagatg       540
     gatattgaag aggaacaaga agaatctact caattcaaaa aaactttgat tagcgaaatt       600
     actgagacct tagtagatcc ttcattggca ttagctattt ctcaagatga tacagcgtac       660
     tccactacaa ctgatttaaa aactgtatca cgtcaacatt gccgtgacaa caaattgtct       720
     tatttacaac cagttatcga aataattgcc aggatcgatc ctgaagctgt ttcagaagtg       780
     tcttcatcaa ctgaattaat caagtcggtc caatggagag accatgaagc aactttatac       840
     aatgacgagc ttgcttataa aattatgaaa ttaactaatg ataatgaaac aaattggaaa       900
     aacttcaatg atgctaacca gtttgatgta ttattatccg gatggtctga gttattagaa       960
     attcatacaa acgatatgga taaaaataag gatgaagatg atcttgaaaa ggtccaagac      1020
     agggccattg tattaacata tattaatttc aatttgttat tcacaaggtt gaagagagat      1080
     ttgttaataa tcgatcaatt atcatctcaa ggtgataatg tttttgcttt aaagaaatta      1140
     gagttcaata aggatattat tagattatat ggtaccataa tcactactac ccaggaaata      1200
     aaagacttgc caggtgttta taatgatgaa gatttacacg aatctttgga taatttggag      1260
     aagtttttcg tcgcaaaaaa atccgctgtt ttggctagat cgtttgctct taataataag      1320
     ttcccagaag cattaaagat atttgatcat gtggataata ccttatcatc ttctgacaat      1380
     aagttctata agattgacga gtttccgtat aacgttagca gcaatgtcga atttgaaaaa      1440
     ttcaaaaagg agttaccttc tcaagtgctt caagctcaaa tattggcaca attctctgta      1500
     gacttatcca agaatttgaa ccagagtaat ttcgtcattg aaaacatgaa taaatatcca      1560
     gtttccaatg aaactttaga caatattgct aacttcaata aaaatttatc aattgctcct      1620
     gttttaagca agcctgtctt atttgatatt gggtttaatt acattaatta tggtatgggc      1680
     cgttcttcat catataataa ctccaattca gctacatcta ctacatctga ttcgactacc      1740
     gatcagaacg atcctaataa aaagaagagt ggcttctttg gtatttttgg ccgtagctaa      1800
//

If you have problems or comments...

PBIL Back to PBIL home page