(data stored in SCRATCH zone)

EMBL: CR848038.ADA

CR848038.ADA         Location/Qualifiers
FT   CDS_pept        complement(153959..154486)
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="CAB143"
FT                   /product="putative DNA methyltransferase"
FT                   /note="Similar to Chlamydia pneumoniae methyltransferase
FT                   ada or cpn0596 or cp0152 SWALL:Q9Z7V8 (EMBL:AE001644) (173
FT                   aa) fasta scores: E(): 6.7e-45, 67.06% id in 167 aa, and to
FT                   Bacillus subtilis methylated-DNA--protein-cysteine
FT                   methyltransferase adaB SWALL:ADAB_BACSU (SWALL:P19220) (179
FT                   aa) fasta scores: E(): 1.5e-05, 39.5% id in 81 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB143"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63601"
FT                   /db_xref="GOA:Q5L6W9"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6W9"
FT                   /protein_id="CAH63601.1"
FT                   /translation="MSENLYLVSDDSKFSLSQACSQGLQIAKYPPLQVIVHFQNNAVVK
FT                   TELSVSPVFSCLFLGPGSHKAMEEIVLLCAKYSQKIDMPRSSYINTSILKKQQEMILNC
FT                   VATIPFGQTHTYGDIAQATDTHPRTVGAVCKQNPFLLFFPCHRVIGSHGERHYCAGKQI
FT                   QDILLNFEGSIS"
     atgtccgaaa atctttactt agtttctgac gattctaaat tttctctatc gcaagcctgt        60
     tctcaaggct tgcagatagc caaatatcct cccttacaag tcatcgttca ttttcaaaac       120
     aatgccgttg taaaaactga gttatcggta tctccggtat tttcttgttt atttttaggt       180
     cccggctctc ataaagctat ggaagaaatc gttttactat gtgcgaaata ctctcagaaa       240
     atagacatgc cacgttcttc ttacatcaat acatcgattc taaagaaaca acaagaaatg       300
     atactcaact gtgtggctac gattcctttc gggcaaacgc acacctatgg agatattgct       360
     caagcaacag acactcaccc tcgtacagta ggagcagtgt gtaagcagaa tccttttctt       420
     ttgtttttcc cctgccacag agtcatagga agtcatggcg aacgccatta ctgtgcagga       480
     aaacagatcc aagatatcct cctcaatttt gaggggtcta taagttag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page