(data stored in SCRATCH zone)

EMBL: CR848038.APBE

CR848038.APBE        Location/Qualifiers
FT   CDS_pept        complement(499163..500107)
FT                   /transl_table=11
FT                   /gene="apbE"
FT                   /locus_tag="CAB433"
FT                   /product="thiamine biosynthesis lipoprotein"
FT                   /note="Similar to Haemophilus influenzae thiamine
FT                   biosynthesis lipoprotein ApbE precursor hi0172
FT                   SWALL:APBE_HAEIN (SWALL:P44550) (346 aa) fasta scores: E():
FT                   3.4e-23, 29.44% id in 326 aa, and to Vibrio cholerae
FT                   thiamin biosynthesis lipoprotein ApbE vc2289 SWALL:Q9KPS3
FT                   (EMBL:AE004300) (367 aa) fasta scores: E(): 1.1e-22, 29.29%
FT                   id in 314 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB433"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63886"
FT                   /db_xref="GOA:Q5L645"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L645"
FT                   /protein_id="CAH63886.1"
FT                   /translation="MGKLSKILLIVLLSYVVQGCSPPLTSFEGERMTMSYRIIVGQHLT
FT                   LQETAELKNDIDAVFKVIDAVYNNWNSESELSKINRSPANVAIPLSNELFAFLKEIDRF
FT                   HRISGGRFDPTLGPLKNLWVLHLKQHSLPNEHTWKAYHQHVGWKHITLDLTNQTITKKH
FT                   ANVQLDLCGAVKGFAVDCLLETCLRFCNNNYVEWGGEIKTSGNHPTGRPWRIASSATPQ
FT                   ILEIHNAAVATSGNSYQQWSVNGKIYTHILDPRTGKPLELHDYPIISATVIHPSCAYAD
FT                   AMATVLMTFATKKEALAWAEENNIQAFINDNAS"
     atgggaaagt tatcaaaaat tctcctcata gttcttttat cttacgtcgt tcaaggatgt        60
     tcgccacctc tcacctcttt tgaaggagag agaatgacca tgtcttaccg gattattgta       120
     ggacaacact taacactcca ggagaccgct gaattaaaaa atgacatcga tgcggtcttt       180
     aaggtaattg atgctgtgta taataactgg aatagcgagt cagaactctc taaaatcaac       240
     cgctctcctg ccaacgtagc gattcccctg tctaacgaat tgttcgcctt cttaaaagaa       300
     atcgatagat ttcaccgcat atccggagga agatttgatc ccacccttgg cccgctaaaa       360
     aatctctggg tactgcatct taagcaacac tctcttccta acgaacacac gtggaaagcc       420
     tatcaccaac atgtcggttg gaaacacatt actttagact taaccaacca aaccatcacc       480
     aaaaaacatg ctaatgtcca actggatctt tgcggtgctg tcaaaggttt tgctgtggat       540
     tgtctactcg aaacctgtct acgtttttgt aataacaact atgtagaatg gggaggggaa       600
     atcaaaactt ctgggaacca ccctactgga cgaccttggc gtatagcctc ttcagcaacc       660
     ccacaaatcc tagaaatcca taatgcagct gttgccacaa gcggaaactc ctaccagcaa       720
     tggtctgtaa atggtaaaat ttacacacat attctagatc ctcgcacagg aaagccctta       780
     gaactacacg actaccccat catatcggct actgtgattc atcctagttg tgcgtatgct       840
     gatgccatgg cgacagtact aatgacattt gcaacaaaaa aagaagcttt agcttgggca       900
     gaagaaaata atatccaagc ctttattaac gataacgctt catag                       945
//

If you have problems or comments...

PBIL Back to PBIL home page