(data stored in SCRATCH zone)

EMBL: CR848038.CMCB

CR848038.CMCB        Location/Qualifiers
FT   CDS_pept        199087..200760
FT                   /transl_table=11
FT                   /gene="cmcB"
FT                   /locus_tag="CAB181"
FT                   /product="membrane protein"
FT                   /note="Previously sequenced as Chlamydophila abortus 60 kDa
FT                   cysteine-rich membrane complex protein CmcB SWALL:Q9AIS7
FT                   (EMBL:AF240773) (557 aa) fasta scores: E(): 0, 100% id in
FT                   557 aa, and highly similar to Chlamydia psittaci 60 kDa
FT                   outer membrane protein precursor Omcb or Mmp2 or EnvB
FT                   SWALL:OM6_CHLPS (SWALL:P23701) (557 aa) fasta scores: E():
FT                   4.8e-217, 97.3% id in 557 aa, and to Chlamydia pneumoniae
FT                   60 kDa outer membrane protein precursor Omcb or Omp2 or
FT                   cpn0557 or cp0195 SWALL:OM6_CHLPN (SWALL:P23700) (556 aa)
FT                   fasta scores: E(): 1e-189, 84.38% id in 557 aa. Only
FT                   significant database matches are to predicted Chlamydiaceae
FT                   proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB181"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63639"
FT                   /db_xref="GOA:Q9AIS7"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR003506"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AIS7"
FT                   /protein_id="CAH63639.1"
FT                   /translation="MSKLIRRVVTVLALTSMASSFASGKIEAAAAESLATRFIASTENS
FT                   NDNVLQATAKKVRFGRNKNQRQEQKHTGAFCDKEFYPCEGGQCQSVDTTQESCYGKMYC
FT                   VRVNDDCNVEISQAVPEYATVGSPYPIEILAVGKKDCVNVVITQQLPCEVEFVSSDPAT
FT                   TPTSDSKLIWTIDCLGQGEKCKITVWVKPLKEGCCFTAATVCACPELRSYTKCGQPAIC
FT                   IKQEGPECACLRCPVCYKIEVCNTGSAIARNVVVDNPVPDGYTHASGQRVLSFNLGDMR
FT                   PGDSKCFSVEFCPQKRGKITNVATVSYCGGHKCSANVTTVVNEPCVQVNISGADWSYVC
FT                   KPVEYTIVVSNLGDLKLYDVVVEDTVPSGATILEAEGAEICCNKAVWCIKEMCPGETLQ
FT                   FKVVAKAQSPGKFTNQVVVKTNSDCGTCTSCAEATTHWKGLAATHMCVIDTNDPICVGE
FT                   NTVYRICVTNRGSAEDTNVSLILKFSKELQPVSSSGPTKGTITGNTVVFDALPKLGSKE
FT                   SVEFSVTLKGIAPGDARGEAILSSDTLTVPVADTENTHVY"
     atgtccaaac tcatcagacg agtagttacg gtcctcgcgc taactagtat ggcgagttca        60
     tttgccagcg ggaagataga ggccgctgct gcagagtctc ttgctacaag attcattgcc       120
     agtaccgaaa actcaaatga caatgttttg caagcaacag ccaagaaagt tagatttggt       180
     cgtaacaaaa atcaaagaca agaacaaaaa catactggcg ctttctgtga taaagaattt       240
     tatccttgcg aaggtggtca gtgccaatcc gtcgatacta cacaagaatc ttgctacggc       300
     aaaatgtatt gtgtccgtgt taacgatgac tgtaacgtgg aaattagcca agctgtacct       360
     gaatatgcaa cagtaggatc tccttatcct attgaaattc ttgctgtagg taaaaaagat       420
     tgcgttaatg ttgtgatcac tcaacaactt ccttgcgaag ttgagtttgt cagcagtgat       480
     cctgcgacaa caccaacctc agatagcaaa ttaatctgga caattgattg cttaggtcaa       540
     ggtgaaaaat gcaaaattac cgtttgggta aaacctctta aagaaggttg ttgcttcacc       600
     gcggctactg tatgcgcttg cccagaactt cgctcttata ccaaatgcgg acaaccagct       660
     atttgtatta agcaagaagg ccctgagtgt gcttgcttac gttgcccagt ttgttacaaa       720
     atcgaagttt gcaacacagg ttctgctata gcccgtaatg ttgtcgttga taaccctgtt       780
     cccgatggct atactcacgc ttcaggacaa cgcgttcttt cctttaactt aggagatatg       840
     cgccctgggg attctaaatg cttctctgtg gagttttgcc cgcaaaaaag aggaaaaatt       900
     actaacgtag ctaccgtatc ttactgcgga ggacataaat gttccgcgaa cgtaactact       960
     gtagttaacg aaccctgcgt acaagtcaat atctctggag ctgactggtc ttatgtatgt      1020
     aagcctgtag aatacactat cgttgtgtcc aacctagggg atcttaaact ttacgatgtc      1080
     gttgtagaag ataccgtacc ttcaggagct acaattttag aagccgaggg agctgaaatc      1140
     tgctgtaaca aagctgtatg gtgcatcaaa gagatgtgcc caggagagac tctacaattt      1200
     aaagttgttg ctaaagcaca aagcccaggt aaattcacaa atcaagttgt tgtcaaaaca      1260
     aactccgatt gtggaacttg cacttcttgt gcagaagcta caacccattg gaaaggtctg      1320
     gcagctactc atatgtgcgt aatcgatacc aatgatccta tttgcgtagg agaaaatact      1380
     gtataccgta tttgtgtaac aaaccgtggt tctgcagaag atactaacgt ttcattaatc      1440
     ctgaagtttt ctaaggagct gcaacccgtt tcttcttcag gcccaacaaa aggaaccatt      1500
     acaggaaata cagtcgtatt cgatgctctg cctaaattag gttctaagga atctgtagag      1560
     ttttctgtaa cattaaaagg gattgcccct ggagatgcac gaggagaggc tattctttct      1620
     tcagatactt taacggtacc cgttgctgat acagaaaata cgcacgttta ttaa            1674
//

If you have problems or comments...

PBIL Back to PBIL home page