(data stored in SCRATCH zone)

EMBL: CR848038.DCD

CR848038.DCD         Location/Qualifiers
FT   CDS_pept        complement(448611..449183)
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="CAB391"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="Similar to Neisseria meningitidis deoxycytidine
FT                   triphosphate deaminase Dcd or Nma1060 or nmb0849
FT                   SWALL:DCD_NEIMA (SWALL:Q9JRE8) (188 aa) fasta scores: E():
FT                   5.1e-54, 68.08% id in 188 aa, and to Pseudomonas aeruginosa
FT                   deoxycytidine triphosphate deaminase Dcd or Pa3480
FT                   SWALL:DCD_PSEAE (SWALL:Q9HYC9) (188 aa) fasta scores: E():
FT                   3.2e-53, 68.08% id in 188 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB391"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63844"
FT                   /db_xref="GOA:Q5L687"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L687"
FT                   /protein_id="CAH63844.1"
FT                   /translation="MSIKEDKWIRKMALAHGMIEPFADGQVNLNPETGEKLISYGLSSY
FT                   GYDLRLSREFKVFTNVYNSLVDPKRFTEDTFISITDDVCIIPPNSFALAHSVEYFRIPR
FT                   NVLTMCIGKSTYARCGLIVNVTPFEPEWEGYVTIEISNTTPLPAKIYANEGIAQVLFFE
FT                   ADEICEVSYAERKGKYQKQQGITVPFV"
     atgagcatta aagaagataa atggattcgc aaaatggcat tggctcatgg aatgatcgag        60
     ccttttgctg atggtcaagt aaatctcaac ccagagacgg gagaaaagtt aatcagctac       120
     ggtttgtcta gctatggtta tgatcttcgt ttgtcccgag aatttaaggt gttcactaac       180
     gtttacaatt ctttagttga ccccaaacgt tttacagaag acacattcat ttcaattact       240
     gatgatgtgt gtatcattcc tccgaattca tttgctctcg ctcatagtgt agagtatttt       300
     cgcattccaa gaaatgtctt aacaatgtgt ataggaaaat ctacatatgc acgttgcgga       360
     cttattgtta atgtaactcc ttttgagcct gaatgggagg gttacgttac catagaaatt       420
     tctaacacta cccccttacc ggcaaaaatt tatgccaacg aaggcattgc tcaggtattg       480
     ttctttgaag ctgatgagat atgtgaagtg tcttatgctg agagaaaagg taaatatcaa       540
     aaacagcagg gaattacagt tccttttgtt taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page