(data stored in SCRATCH zone)

EMBL: CR848038.DNAA

CR848038.DNAA        Location/Qualifiers
FT   CDS_pept        529040..530422
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CAB459"
FT                   /product="chromosomal replication initiator protein"
FT                   /note="Similar to Escherichia coli chromosomal replication
FT                   initiator protein DnaA or b3702 SWALL:DNAA_ECOLI
FT                   (SWALL:P03004) (467 aa) fasta scores: E(): 2.1e-31, 30.5%
FT                   id in 472 aa, and to Bacillus halodurans chromosomal
FT                   replication initiator protein DnaA or bh0001
FT                   SWALL:DNAA_BACHD (SWALL:Q9RCA2) (449 aa) fasta scores: E():
FT                   5e-35, 30.68% id in 453 aa. Note also similar to CAB358
FT                   25.917% id in 436 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:CAB459"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63912"
FT                   /db_xref="GOA:Q5L619"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L619"
FT                   /protein_id="CAH63912.1"
FT                   /translation="MRAWEDFLLLQEKEIGTSTVDKWLRSLKVLCFDACNLYLEAKDSF
FT                   QVTWFEEHIRHKVKTSLVNNNGKLIRVHVTSLDKTTPFYKEKQMQQEKTAYFTMQYGNV
FT                   NPEMTFANFLVTPENDLPFRILQEFTKPSEDATGFPFNPIYLFGPEGSGKTHLMQAAVN
FT                   VLRESGGKILYVASDLFTEHLVSAIRSGEMQRFRSFYRNVDALFIEDIEVFSGKGATQE
FT                   EFFHTFNSLQTEGKLIVISSAYAPADLKAMEERLISRFEWGVAVLIHPLTKEGLRSFLM
FT                   RQTEQLSIRIEDSALDFLIHALSSNMKALLHALTLLSKRVAYKKLTQQLLYEDDIQSLL
FT                   HDVLEAAESVRLTPSGIVHAVAKYYGVSPESILGRSQSREYVLPRQVAMYLCRQKLSLS
FT                   YVRIGDVFSRDHSTVISSIRAISQKVEEGGHDISIATQDLMKYLTSAYKSLEFFPEEEI
FT                   PC"
     atgcgggcgt gggaagactt tcttttgcta caagaaaaag aaatcggtac gagtactgta        60
     gacaaatggt taaggtcgtt aaaagtccta tgctttgatg cgtgtaattt gtatcttgaa       120
     gccaaagatt cttttcaagt gacttggttt gaggagcata tacgccacaa ggtaaaaaca       180
     agtttagtga ataataacgg gaagttaatt cgtgttcacg ttacttccct cgataaaact       240
     actcctttct ataaagaaaa gcagatgcag caggaaaaaa ctgcctattt tactatgcag       300
     tatggcaatg tcaatcctga aatgactttt gctaattttc ttgtgacacc tgaaaatgac       360
     ttgccgtttc gtattttaca ggagtttaca aaaccttcag aagatgctac aggctttcct       420
     tttaacccca tttatctttt tggaccagag gggtcgggga aaacacattt aatgcaagct       480
     gctgtaaatg ttcttcggga atctgggggt aaaattcttt acgttgcttc agatttattt       540
     actgaacatt tagtttctgc catacgttct ggagaaatgc agagatttcg ttctttttac       600
     cgtaatgtcg atgctttatt tatagaggac atagaagtat tctcgggtaa aggagctact       660
     caggaagagt ttttccatac ttttaattcc ttgcaaacag aaggtaagtt gattgttatc       720
     tcatcggcat atgctcctgc agacttaaaa gcaatggaag aacgcttaat tagtcgtttt       780
     gaatggggag tcgctgttct tatccatcct ttaacgaaag agggattaag aagttttctc       840
     atgcgacaaa cagagcaatt atctatccgc atagaagact cagctttgga cttcttaatt       900
     cacgcactat cttcaaacat gaaagcgcta ctacatgcgt taactttgct ttcaaagcgt       960
     gttgcttata aaaaactaac tcagcaactg ctctatgaag atgatataca atctctctta      1020
     cacgatgtat tagaagctgc ggaaagtgtg cgtttaactc cttcaggaat tgtgcatgct      1080
     gtggctaagt attatggagt gtctccagag agtattttag ggcgttcaca atctcgagag      1140
     tatgtcttgc ctagacaagt cgctatgtac ttatgtcggc agaaattgtc tttatcctac      1200
     gtaaggatag gggatgtatt ttctagagat cattcaacag taatttcatc aatacgtgct      1260
     atttctcaaa aagtagaaga aggtgggcac gacattagta ttgctacgca agacttaatg      1320
     aagtatttaa cttcagcgta taagagtctt gagtttttcc ctgaagaaga aatcccttgt      1380
     tag                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page