(data stored in SCRATCH zone)

EMBL: CR848038.DPPD

CR848038.DPPD        Location/Qualifiers
FT   CDS_pept        complement(72989..73951)
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="CAB059"
FT                   /product="putative peptide ABC transport ATP-binding
FT                   protein"
FT                   /note="Similar to Chlamydia pneumoniae ABC ATPase dipeptide
FT                   transport dppD or cpn0682 or cp0065 SWALL:Q9Z7M2
FT                   (EMBL:AE001650) (324 aa) fasta scores: E(): 3.3e-73, 68.73%
FT                   id in 323 aa."
FT                   /db_xref="EnsemblGenomes-Gn:CAB059"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63517"
FT                   /db_xref="GOA:Q5L751"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L751"
FT                   /protein_id="CAH63517.1"
FT                   /translation="MTHPPILQVKDLSVSLHKRRAHYPIVESLSFDLHKGKTLAIIGES
FT                   GSGKSVTAQALMQLLPSPLFSTSGEILFHGKDLFKAPRGILRSIFGTKISMIFQNPQSS
FT                   LNPVFTIEQQFQELIRTHLHLPTQEGKNKIIQALIDTGFHNPELCLKLYPHQLSGGMLQ
FT                   RVSIAMALLTSPEILIADEPTTALDVSVQYQILQLLKGLQNKLGMALLIITHNMGVVAE
FT                   TADDVLVLYAGRLAEYAPVKDIFHNPCHPYTQDLLASRPSLQSETFTTIPGQPPHYSAL
FT                   PSGCCYYPRCSKAYGKCKVESPEAQQVTEGHKVRCWLYE"
     atgactcatc cacctatctt acaagttaag gatctatcgg taagtctgca taaacgtcgg        60
     gcacattacc ctattgttga gtcattgtct tttgatctgc ataaagggaa gactttagcg       120
     attattggcg aatccggttc ggggaaatcg gtaacagcgc aagcgcttat gcaattatta       180
     ccctccccac tattttctac atcgggggaa atattgttcc atgggaagga cttattcaaa       240
     gctccgcgag gtatcttacg ttctatcttt ggaacaaaga tttctatgat ttttcaaaat       300
     cctcaatctt cattaaaccc tgtctttaca atagaacaac aattccaaga gcttatccgc       360
     acacacttac acctacctac tcaagagggg aaaaataaaa ttatacaagc tctcatagat       420
     acaggatttc ataatcccga actctgttta aagctctatc ctcatcagct ctcgggaggg       480
     atgctgcaaa gagtttccat tgctatggct ttacttacct ctccagaaat tctcattgct       540
     gatgagccaa caacagctct tgatgtttct gttcaatacc agattttaca attactcaaa       600
     ggcctacaga acaaactcgg catggccttg cttatcatta cccacaacat gggcgtcgtt       660
     gccgaaactg cggatgacgt actcgttctc tatgcaggga gactcgctga gtatgctcca       720
     gtaaaggata ttttccataa tccttgccat ccttatactc aagatttact cgcttctcgt       780
     ccttcattgc aaagtgaaac atttacgaca attcctgggc agcctcccca ctacagtgcc       840
     ctgccttccg gatgctgcta ctaccccaga tgctcaaaag cttatggaaa atgtaaagtc       900
     gaatctccag aagctcagca agtgacagaa ggacataaag taaggtgttg gttatatgaa       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page