(data stored in SCRATCH zone)

EMBL: CR848038.HISS

CR848038.HISS        Location/Qualifiers
FT   CDS_pept        93851..95143
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="CAB078"
FT                   /product="putative histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="Similar to Chlamydia pneumoniae histidyl-tRNA
FT                   synthetase HisS or cpn0663 or cp0084 SWALL:SYH_CHLPN
FT                   (SWALL:Q9Z7P1) (430 aa) fasta scores: E(): 1.4e-132, 74.18%
FT                   id in 430 aa, and to Escherichia coli, and Escherichia coli
FT                   O157:H7 histidyl-tRNA synthetase HisS SWALL:SYH_ECOLI
FT                   (SWALL:P04804) (423 aa) fasta scores: E(): 1.5e-48, 38.09%
FT                   id in 399 aa."
FT                   /db_xref="EnsemblGenomes-Gn:CAB078"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63535"
FT                   /db_xref="GOA:Q5L735"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L735"
FT                   /protein_id="CAH63535.1"
FT                   /translation="MKVALPKGVFDIFPYITDAKHMWRHTSLWHRVEDVIHDVCGLYGF
FT                   SEIRTPVFEKSEVFLHVGEQSDIVKKEMYTFLDKKGRSLTLRPEGTAPIVRSFIDNSMN
FT                   QRDDNKFYYILPMFRYERQQSGRYRQHHQFGVEAIGVRHPLRDAEILALLWHFYSAVGL
FT                   QHMQVQLNFLGGEVTRKRYDKILREYFLDHLSSLSLLSKERFNTNLLRILDSKEPEDQE
FT                   IIQSAPPILDYVSDDDRKYFDEILSALDALNIAYDINPRLVRGLDYYTDLVFEAITTCR
FT                   DHSYALGGGGRYDGLIASSGGPATPACGFGIGLERVIQTLLAQGNFTPLSSHKLRLIPV
FT                   ESQADSFCFVWAQHLRSLGIPTEVDWTHKKLKNALKIADAEKATFVCPVGERELVSEQL
FT                   TVKNMSLRQEFSGSKQEVEQRLLYEIQNTSL"
     gtgaaagtag ctttgcccaa aggggtgttc gatatattcc cttacattac ggatgcgaaa        60
     catatgtgga gacacacttc tctatggcat cgggtcgagg atgtgattca tgacgtatgt       120
     ggtctatacg ggttttcaga aattcgtacg cctgttttcg aaaagtcgga agtgtttttg       180
     catgtcgggg aacaaagtga cattgtaaaa aaagaaatgt atacctttct ggataagaaa       240
     gggcggtcat tgacactgcg tcctgaagga accgctccca tagtgcgctc gttcatagat       300
     aattctatga accaacgtga tgacaataaa ttttattata ttctgcctat gttccgttat       360
     gaaaggcagc agtcaggaag gtaccgtcag catcatcagt ttggggtaga agctataggg       420
     gtgcgtcatc ctctccgtga tgcggaaatc cttgctttac tttggcattt ttattctgct       480
     gtgggtttgc agcacatgca agtgcaattg aactttttag gtggggaggt tacacgcaaa       540
     cgctacgata agattttgcg agaatacttc cttgatcatt taagttcttt atctttgcta       600
     agtaaagaac gatttaatac aaatttattg aggatattgg attccaaaga gccagaagat       660
     caagagatta tccaatccgc acccccgatt cttgactatg tttctgatga tgatcgtaaa       720
     tattttgatg aaattctttc tgctttagat gctttaaaca ttgcctatga tattaacccc       780
     aggcttgtgc gtggtttaga ttactatacg gatctagttt ttgaagcgat cacaacatgt       840
     agagatcatt cctatgcttt gggaggagga gggcgctatg acggcctgat tgcttcttct       900
     ggagggccag ccactcccgc ttgtggtttt ggcattggtt tagagagggt gattcagact       960
     ttattggcgc aagggaattt cacaccgcta tcctctcaca aattgcgttt gatcccggtg      1020
     gagtcgcagg ccgactcttt ttgttttgtt tgggcacagc atttacgtag tttaggaatc      1080
     cctacagaag tggattggac gcataaaaaa ttaaaaaatg ctttaaaaat agcagatgcg      1140
     gagaaagcca cttttgtctg tcccgtggga gaaagagagt tggtttcaga gcaattgaca      1200
     gtgaagaata tgtctttgcg ccaagagttc tctggttcaa agcaagaggt agagcaaagg      1260
     ttgctatatg aaatacagaa cacatcgttg taa                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page