(data stored in SCRATCH zone)

EMBL: CR848038.INFB

CR848038.INFB        Location/Qualifiers
FT   CDS_pept        complement(517852..520476)
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="CAB451"
FT                   /product="translation initiation factor"
FT                   /note="Similar to many translation initiation factors
FT                   including: Neisseria meningitidis translation initiation
FT                   factor If-2 Infb or Nma1897 SWALL:IF2_NEIMA (SWALL:Q9JTB5)
FT                   (962 aa) fasta scores: E(): 5.9e-73, 35.5% id in 904 aa and
FT                   Listeria monocytogenes translation initiation factor If-2
FT                   Infb or lmo1325 SWALL:IF2_LISMO (SWALL:Q8Y7F6) (779 aa)
FT                   fasta scores: E(): 9.6e-74, 39.39% id in 731 aa. Note the
FT                   overlap with the upstream CDS"
FT                   /db_xref="EnsemblGenomes-Gn:CAB451"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63904"
FT                   /db_xref="GOA:Q5L627"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L627"
FT                   /protein_id="CAH63904.1"
FT                   /translation="MKIKNAQLTKAAGLDKLKQKLAQAGSSDTKSSSEKPTTKVPEKVA
FT                   KEKVVKKKSVLDSSVPTMAEHVSTETSPRRIRAKNRSSFASEDSTIPSPVSVDTESTAF
FT                   SPPVVEEVVSPLESAEPEIVEPTPASIVDEPETTIQEPPPPKKEAELVVKKEPPKNVVS
FT                   IKSNFGPTGKHINHLLAKTFKAPKKEDKPAPKERTGTVQTKPQQSSEVPSDKQHSSNNR
FT                   QSQPFYRRDTSKRPGSDFRDRSKKDDSPKAFTGRDRYGLNDSSDDDKWRKKRVQKTKKH
FT                   YDEHSVQRPTHIKVPLPITIKDLAAEMKLKASELIQKMFIHGMTYVVNDVLDNETTVQF
FT                   IGLEFGCTIDIDSSEQDKLCIESNTVKEEIQETDPSQLIIRPPIVAFMGHVDHGKTTLI
FT                   DSLRKSNVAAVEAGAITQHMGAFCCSTPVGNITILDTPGHEAFSAMRARGAEVCDIVVL
FT                   VVAGDEGIKEQTLEAVKHARAANITIVVAINKCDKPNFNADTVYRQLSEINLLPEAWGG
FT                   TTVTINTSAKTGEGLSELLEMLALQAEVLELKANPEARARGIVIESELHKGLGAVATIL
FT                   VQNGTLHLGEALVFNDCYGKVKTMHNEHNQLMTSASPSVPALITGLSSMPKAGDPFVVV
FT                   KNEKTAKEIVNARIAGQQKFALQKKRPNFDAMLQNKKILKLIIKADVQGSIEALSSSVL
FT                   KIVSDKVSAEILSSSVGEISESDIRLAAASKAVIIGFHTGIESHAESLIKNLGVKVHLF
FT                   NIIYHAVDAVKEMMTALLDPIAEERNLGSAEIKETFKSSQLGTIYGCLVSEGVMTRNQK
FT                   VRVVRNNEVLWKGNLSSLKRIKEDVKEVKKGLECGILLEGYQNAQVGDILQCYEVIYHP
FT                   QKL"
     ttgaagatta aaaacgctca attaacgaaa gctgctggat tagataaatt aaagcaaaaa        60
     ttagctcagg caggatcttc agacacaaaa agctcttcag aaaagcctac gactaaggtt       120
     cctgaaaaag ttgctaaaga aaaagtcgtg aagaaaaaga gtgttctaga ttctagcgta       180
     cctacgatgg ctgagcatgt ttctactgaa acttctccac gcagaattcg agctaaaaat       240
     cgttcatctt ttgcgtctga agattcaacc attccttctc ctgtttccgt agataccgag       300
     tctactgcgt tctcccctcc tgttgtggaa gaagtggttt ctcccctgga gtccgctgag       360
     ccggaaattg tagagcccac tcccgcttct atagtagacg aacctgaaac aactattcag       420
     gagccccctc ctccaaagaa agaagccgaa ttagtagtta aaaaggaacc tcctaaaaat       480
     gttgtttcta tcaagtcgaa tttcgggcct accggaaaac atattaatca cttgttagcg       540
     aagactttta aagctcctaa aaaagaagat aagcctgcgc ctaaagaacg cacaggaaca       600
     gttcaaacaa agcctcaaca atcttctgaa gttcctagtg ataaacaaca ttcttcaaac       660
     aatcgacagt ctcaaccttt ttatcgtagg gatacgtcaa agagacctgg atctgatttt       720
     agagatcgtt cgaaaaaaga tgacagtcct aaggcattta caggtagaga tcgctatgga       780
     ttaaacgaca gtagcgatga cgataagtgg aggaaaaaac gtgttcaaaa aactaagaaa       840
     cactatgacg aacactcagt acagcgcccc actcacatta aagtgcctct gcctattacg       900
     attaaggatc ttgctgcaga aatgaagctt aaagcttctg aactgatcca aaaaatgttt       960
     attcatggta tgacgtacgt tgtcaatgac gtattagata atgaaacaac ggtacaattt      1020
     attggattag agtttggctg tactatcgat atcgattcat cagaacaaga taagctctgt      1080
     atcgaaagta atactgttaa agaagaaata caagaaacag atccaagtca attaatcatt      1140
     cgtcctccta tcgtagcttt tatgggccac gtggatcatg gaaaaactac tttaattgac      1200
     tcgctaagaa aaagtaatgt ggcagcagta gaagctgggg ctattacaca gcatatggga      1260
     gccttctgtt gttctacacc tgttggaaat attactatct tggatactcc tggccacgaa      1320
     gccttttctg ctatgagagc tcgaggtgcg gaagtttgcg atatcgttgt acttgtagtt      1380
     gccggggatg aaggaatcaa agaacaaact ttggaagccg tcaaacacgc tcgtgcagca      1440
     aatatcacta ttgttgtagc aatcaataag tgtgataaac ccaatttcaa tgcagatact      1500
     gtttacagac aactttctga aatcaaccta ttgccagagg catggggagg tacaacggta      1560
     acaattaata cctctgcaaa aactggcgaa ggtttatctg agcttttaga aatgcttgct      1620
     ctacaagcag aagttttaga gttaaaagcg aatccagagg ctcgtgctcg tggaattgtt      1680
     atcgaatctg agctacacaa aggtttaggt gcagtagcaa cgattttagt gcaaaacggt      1740
     accctacatc ttggtgaagc attagttttc aatgattgtt atggcaaagt taaaacaatg      1800
     cataacgaac ataaccagct aatgacatcg gccagtcctt ctgtcccagc tttaatcaca      1860
     gggctatcta gtatgcccaa ggcaggtgat ccttttgttg tcgttaaaaa cgaaaaaaca      1920
     gctaaggaaa ttgttaatgc tagaattgct ggccaacaga aatttgcttt gcaaaagaaa      1980
     cgtcctaatt ttgacgctat gctgcaaaat aaaaagatcc ttaaacttat tatcaaagcg      2040
     gatgttcaag gatctattga agctttgtcc agttctgtct taaaaattgt ttctgataaa      2100
     gtaagtgccg aaattctttc gagtagcgtt ggagaaattt ctgagtccga tattcgtttg      2160
     gcggcagcat ctaaagccgt aattattggt ttccatacgg gtatagaaag ccacgccgaa      2220
     tctctgatca aaaacttagg agtcaaagta catttgttta acattatcta ccatgctgta      2280
     gatgctgtta aagaaatgat gacagcattg cttgatccta ttgctgaaga gagaaacctt      2340
     ggttctgctg aaatcaaaga aaccttcaag tcatcacaat taggtacaat ttatggttgc      2400
     ttggtttccg aaggtgtaat gactagaaat caaaaagtac gtgttgtacg caataatgaa      2460
     gttctttgga aaggtaactt atcttcatta aaacgtatta aagaagacgt taaagaagtt      2520
     aaaaaagggc ttgaatgcgg tattttatta gaaggatatc agaatgctca ggtaggtgat      2580
     attctacaat gttacgaagt gatatatcat ccacaaaagc tttag                      2625
//

If you have problems or comments...

PBIL Back to PBIL home page