(data stored in SCRATCH zone)

EMBL: CR848038.PDHA

CR848038.PDHA        Location/Qualifiers
FT   CDS_pept        complement(535838..536863)
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="CAB464"
FT                   /product="pyruvate dehydrogenase e1 component, alpha
FT                   subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="Similar to the N-terminal alpha subunits of:
FT                   Rhizobium meliloti pyruvate dehydrogenase E1 component,
FT                   alpha subunit PdhA SWALL:ODPA_RHIME (SWALL:Q9R9N5) (348 aa)
FT                   fasta scores: E(): 9e-38, 40.13% id in 304 aa and
FT                   Rickettsia sibirica pyruvate dehydrogenase E1 component
FT                   alpha subunit SWALL:EAA25604 (EMBL:AABW01000001) (326 aa)
FT                   fasta scores: E(): 1.3e-39, 39.81% id in 319 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB464"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63917"
FT                   /db_xref="GOA:Q5L614"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L614"
FT                   /protein_id="CAH63917.1"
FT                   /translation="MPDAFHYNIASKASDEATVKNIIDIYGPPRCVELLKYMLLIREFE
FT                   TRGEEAYLEGLVGGFYHSYSGQEAVATAALANTGLDQWFFSSYRCHALAVLLNIPLRSL
FT                   AAELLGKETGCALGRGGSMHMCGPNFPGGFGIVGGQIPLAAGAAFAIKYRGEDKISLGF
FT                   MGDGAVAQGVFHETLNFTALHSLPLMLIIENNGWGMGTALNHAIAKQPIGESQGASYGI
FT                   RSFTLNGFDLFNCLLGFKEAYEYMQKTRLPVIVECLCSRFRGHSISDPNLYRSKEEMEC
FT                   LIKKDPIVFAKKWLIQLGVMSEESFQALREECKNKVLKAFTEAKSDPEPTIATLEEGVY
FT                   A"
     atgcccgacg cttttcatta caatatcgct tctaaagcat ctgatgaagc aactgtaaaa        60
     aacattattg atatatatgg cccccctcgt tgtgtagaac tcttgaaata catgttactc       120
     attcgtgagt ttgaaacacg aggagaagag gcatatttgg aaggtttggt tggtggtttt       180
     taccactcct atagtggtca agaagcggtt gctaccgcag cattggctaa tacaggatta       240
     gatcaatggt ttttctcttc ctaccgctgt cacgctcttg ccgtattact gaatatcccc       300
     cttcgctccc ttgcagcaga attactaggt aaagaaaccg gttgcgcctt aggtcgaggc       360
     gggtctatgc atatgtgtgg tccaaatttc ccaggaggat ttggaatcgt aggaggtcaa       420
     attcccttag ctgcaggagc agcattcgct atcaaatatc ggggtgaaga taagatctct       480
     ctaggattca tgggagatgg agcagtggct caaggggtat ttcacgaaac gttaaatttt       540
     actgctctac atagcctccc tttaatgctg attatagaaa ataatggctg gggcatgggg       600
     actgctctca atcatgctat tgcaaagcaa ccgataggag aatcccaagg agcttcttac       660
     ggtatacgtt cattcacttt aaacggcttt gaccttttca attgtctttt aggctttaaa       720
     gaagcttatg agtacatgca aaagacgcga ctccccgtca ttgttgaatg cttatgttct       780
     cgatttagag gacactccat ttccgatccc aacctgtata gaagtaaaga agaaatggaa       840
     tgcctgatca aaaaagatcc tatcgttttc gctaaaaaat ggctgatcca gttgggagta       900
     atgtcagaag aaagttttca agcattacgt gaggaatgta agaataaggt tttaaaagct       960
     tttactgaag caaaatcaga tccagaacca acgattgcta cattagaaga aggtgtgtat      1020
     gcctaa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page