(data stored in SCRATCH zone)

EMBL: CR848038.PE10

CR848038.PE10        Location/Qualifiers
FT   CDS_pept        complement(15832..16812)
FT                   /transl_table=11
FT                   /locus_tag="CAB010"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlamydia trachomatis hypothetical
FT                   protein Ct627 ct627 SWALL:Y627_CHLTR (SWALL:O84632) (327
FT                   aa) fasta scores: E(): 3.1e-105, 80% id in 325 aa, and to
FT                   Chlamydia muridarum hypothetical protein Tc0916 tc0916
FT                   SWALL:Y916_CHLMU (SWALL:Q9PJB6) (328 aa) fasta scores: E():
FT                   7.7e-103, 77.84% id in 325 aa, and to Chlamydia pneumoniae
FT                   hypothetical protein cpn0734 or cp0012 or cpj0734
FT                   SWALL:Y734_CHLPN (SWALL:Q9Z7H1) (324 aa) fasta scores: E():
FT                   5.8e-106, 78.15% id in 325 aa."
FT                   /db_xref="EnsemblGenomes-Gn:CAB010"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63468"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L7A0"
FT                   /protein_id="CAH63468.1"
FT                   /translation="MKKNYYALAYYYLTRVDNPQQEIALHKELFKDLDVSCRIYISEQG
FT                   INGQFSGYQPDAEYYMNWLRQRPGFSNVKFKIHHIEENIFPRVTVKYRKELVALGCDVD
FT                   LSNQGKHISPQEWHEKLEENRCLVLDVRNNYEWKIGHFENAVLPDIRTFREFPDYAEQL
FT                   SKEHDPATTPVMMYCTGGIRCELYSSLLLEKGFKEVYQLDGGVIAYGQAVGTGKWRGKL
FT                   FVFDDRLAVPIDEADTDVPPIASCSHCETPCDTYYNCANTDCNNLFICCKECIHSTKGC
FT                   CSQECSQAPRIRSFAPCRGNKPFRRMHLCEVTKEKEEAASSCCLH"
     atgaaaaaga attattacgc tttagcttat tattatttga ctcgtgtaga taatcctcaa        60
     caggaaattg cgttgcacaa ggaactattt aaagatttag atgtttcttg tcgtatctac       120
     atatctgaac aagggattaa tggccagttt agtggctatc aaccggacgc agagtattac       180
     atgaactggc taagacagcg tcctggattt tcaaatgtaa aatttaaaat ccatcacatt       240
     gaagaaaata ttttccctcg tgtaactgtg aaatatcgca aagagcttgt cgctcttggt       300
     tgcgacgttg atttatctaa tcaagggaag catatttctc cgcaagagtg gcatgaaaag       360
     ctcgaggaga atcgctgtct agttttagat gtaagaaata attacgaatg gaaaataggg       420
     cattttgaaa atgctgtgct tccagacatt cggacttttc gggaattccc tgattatgct       480
     gaacagttat ccaaagaaca cgacccagct accacccctg tgatgatgta ttgtactggt       540
     ggcatacgtt gtgaattgta ctcttccctc cttttagaaa aaggttttaa agaagtgtat       600
     caacttgatg gtggtgttat tgcttatggt caggctgtag gcacaggtaa atggcgaggt       660
     aagctattcg tatttgatga tcgtttagct gtacctattg atgaagcgga tactgacgtt       720
     cctcccatcg cctcgtgctc acattgtgag actccctgtg acacttacta caactgcgca       780
     aatacagact gtaataattt attcatctgt tgtaaggagt gtatccattc aacaaaagga       840
     tgttgttctc aagagtgttc tcaagcacct cggattcgct cctttgcccc ctgtagagga       900
     aacaagcctt tccgccgtat gcatctctgt gaagtaacaa aagagaagga agaagctgct       960
     agctcctgct gtctacacta g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page