(data stored in SCRATCH zone)

EMBL: CR848038.PE130

CR848038.PE130       Location/Qualifiers
FT   CDS_pept        complement(139101..139361)
FT                   /transl_table=11
FT                   /locus_tag="CAB130"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlamydia pneumoniae ct490 hypothetical
FT                   protein cpn0609 or cpj0609 or cp0138 SWALL:Q9Z7U5
FT                   (EMBL:AE001645) (94 aa) fasta scores: E(): 1.2e-08, 44.18%
FT                   id in 86 aa. Only significant full-length database matches
FT                   are to Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB130"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63588"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6Y2"
FT                   /protein_id="CAH63588.1"
FT                   /translation="MLIRLFFGIPLSKGLENIHEYPLTVAIFQKKEYLGIYSPAQASLP
FT                   VAQLPTYYQQAQEILEKVLPEKYLSGGETSLLVFPDILIGK"
     atgcttattc gtttattttt tggtattccc ctatctaagg gattagagaa catccatgag        60
     tatcccttaa ctgtggctat ctttcaaaaa aaagaatact taggaatcta cagccctgca       120
     caagcttctt taccagttgc acaactccct acatattacc aacaagctca ggaaattcta       180
     gagaaagtat taccagaaaa atatctctct gggggagaga cttccctact agtttttcct       240
     gacattctca ttggcaaata a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page