(data stored in SCRATCH zone)

EMBL: CR848038.PE134

CR848038.PE134       Location/Qualifiers
FT   CDS_pept        142364..142927
FT                   /transl_table=11
FT                   /locus_tag="CAB134"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlamydia trachomatis methylase yhhf or
FT                   ct487 SWALL:O84494 (EMBL:AE001322) (190 aa) fasta scores:
FT                   E(): 7.5e-45, 66.31% id in 187 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB134"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63592"
FT                   /db_xref="GOA:Q5L6X8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6X8"
FT                   /protein_id="CAH63592.1"
FT                   /translation="MKILAGKYKGKSLKTFSNPSVRPTCGVVKEAVFNICSVYVEDARF
FT                   LDLFAGVGSVGFEALSRGAASVTFVDSSAQSVRLIRANSQLLHPNLPITIIKQEARSAI
FT                   QRLAKKNMSFDLIYIDPPYNLEDSYLAAVLRDIVVGGILDKHGCLFLENASMEPILVEG
FT                   LIRKRSRKLGGTCLSEYVFEDSSN"
     ttgaaaattc ttgctggcaa atacaaagga aagtctttaa aaactttctc taatccttca        60
     gtccgtccta cttgtggcgt ggtcaaagag gccgtgttta acatctgttc tgtctatgtt       120
     gaggacgcga gatttttaga tctttttgct ggagtgggat ctgtggggtt tgaagcctta       180
     agtcgcggag ctgcttcagt aactttcgta gattcttctg cacaatctgt ccgattaatt       240
     cgggcaaata gccaactttt gcacccgaat ttgccaatta caattatcaa acaagaggca       300
     aggtcagcaa ttcaacggtt ggccaaaaag aacatgtcgt ttgacctcat ttacatagat       360
     cctccctata atcttgaaga tagctatctt gccgccgtat tgcgtgatat cgtggtcggt       420
     gggattttag ataaacacgg gtgcttattt ttagaaaatg cttctatgga acccatcctt       480
     gttgaaggtc taatacgaaa acgtagtagg aaactgggag gcacatgttt atcagaatat       540
     gttttcgaag acagttctaa ttag                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page