(data stored in SCRATCH zone)

EMBL: CR848038.PE151

CR848038.PE151       Location/Qualifiers
FT   CDS_pept        complement(161638..162222)
FT                   /transl_table=11
FT                   /locus_tag="CAB151"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlamydia pneumoniae ct469 hypothetical
FT                   protein cpn0588 or cpj0588 or cp0160 SWALL:Q9Z7W6
FT                   (EMBL:AE001643) (181 aa) fasta scores: E(): 3.6e-40, 58.91%
FT                   id in 185 aa. Only significant full-length database matches
FT                   are to Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB151"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63609"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6W1"
FT                   /protein_id="CAH63609.1"
FT                   /translation="MTIMSSSNQLSHQDSTSFNDQVTTNTDSLTIFDPIRYKILASTPE
FT                   EKVRQELITCLVEELHYPPSLIIVEKGLKTLFPLLSRKEIRLPRRRPDLLVITPATYTD
FT                   AEGKTYNLGEPRPLLLIECKARVINQQTLNQLLSYNYIIGSPCISVVCYKKQQTGFLNP
FT                   KTHTLDFYPGLPCYSQLISYYLTLNSVQPIN"
     atgacaatta tgtcctcatc gaaccaatta tcgcaccagg attccacatc ttttaatgat        60
     caggtcacga cgaacacaga ttctctcacc atctttgacc cgatacggta taaaatcttg       120
     gcatcgacac ctgaagaaaa ggtacgtcaa gagctcatta cttgtctcgt tgaggaattg       180
     cactacccgc cgtccctaat tattgtcgaa aaaggtctga agactttatt tcctcttctt       240
     tctcgtaagg agatacgctt gcctcgacgt cgtcccgatc tcttggtgat cacaccagca       300
     acatatacgg atgccgaggg gaaaacctac aacttaggag agcctcgccc cctgctgttg       360
     attgaatgta aagcacgagt aattaaccaa caaacactca accaattatt aagctacaac       420
     tatattatcg gatctccatg catctctgtt gtttgctaca aaaaacaaca aacaggattt       480
     ctcaatccca agacacacac tttagatttt tatccaggac taccgtgcta ttcccaactg       540
     atctcctact atctgacgct aaactctgta caacctataa actaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page