(data stored in SCRATCH zone)

EMBL: CR848038.PE17

CR848038.PE17        Location/Qualifiers
FT   CDS_pept        26660..29317
FT                   /transl_table=11
FT                   /locus_tag="CAB017"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlamydia pneumoniae hypothetical protein
FT                   Cp0020 SWALL:Q9K2E9 (EMBL:AE002166) (812 aa) fasta scores:
FT                   E(): 2e-138, 53.9% id in 846 aa. Only significant
FT                   full-length database matches are to Chlamydiaceae
FT                   proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB017"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63475"
FT                   /db_xref="InterPro:IPR007606"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L793"
FT                   /protein_id="CAH63475.1"
FT                   /translation="MLILLKIKVNKTVFRMDIINSYSVSANYKKLPILPCSDSIQKRHQ
FT                   LLESVFHYEKTEFERYVVQRLICILDQKADEKYRQLIDKLHKFEIEDRVIPKENRVSAV
FT                   HRKPLSDLHAPIAVVATTSAVGSSDSLPTEDPFYNATKQQWAHNLLGEIKNVVDKIVGA
FT                   VVRLAGKPTLLPRDGSVRSSIEKVEKEPEKPSQEELDKAALLKIQTEVQRLFDLGTNLT
FT                   NADFESLYRLSKQIFDTVQTSTLFMGGQKTDFINELSAEYGNADQLAQVFADGRIEGLK
FT                   DVLNVVKRKLTEEEYSIFSEVEKALASLQTSVHTYDQEKFDLIDQIGDELADTINASAL
FT                   SRNDKIDLCAQISYLYKDQVSAVDSFNVVVDATIFVNSHQEAIFDQISNLVSSLMGVFA
FT                   PINLGQVTTEISSAAIAGALQAVRAINSRFNDLTDAQQKLVNDAFKTLTTFKAPSYIGA
FT                   IWAYFVASTVLATNTTASMENIGAVIREAAKEMGSSKLDIASSIKTTMENIVSANGQFK
FT                   PGNTDNGQEETYTIYSQQNGSGVKINAQLLNRGNVGFLPKITVAANAHAESTARAYFAF
FT                   KGLAGVQIAQLQSKIDESRGQLKDYQALKAELYKDQLYAQSNELQAMALPSAVASVLID
FT                   RYMPKEVGFLNGIYDQLYYSNLGSSVGNAMIDVISEYVNAATYFNFASYVGQQPAVGQK
FT                   GKDVFPGTADSARNKLETERKKAAAYLKSTQDAKIVLEEQVKRVTEDSKISNEQRTRII
FT                   DSLNNYRDNLNVISGSLVLLQNYLAPLGVSEGEVAGTFQVTGGEEQWQARLEILEDALV
FT                   SGLSGNAISGGMFPLQATIQSDQQSYADMGQNYQLELQMHLTSMQQEWTVVATSLQVLN
FT                   QMYLSLARSLMGNL"
     atgttaattt tattaaaaat aaaagttaac aagactgttt tccgtatgga tatcatcaat        60
     agttactctg tttcagcaaa ttataaaaaa ttaccgatac taccttgctc agattcaata       120
     caaaaacgcc accagttatt agaaagtgtt tttcattacg aaaagactga gtttgaacgt       180
     tatgtagtgc agagattgat ctgtatttta gatcaaaaag ctgatgaaaa gtaccggcag       240
     ttaatagata aactgcataa gtttgaaata gaagaccggg tgatccctaa ggaaaatcga       300
     gtttcagctg ttcatcgtaa gcctttatca gatttacacg ccccgattgc cgttgtagct       360
     acgacttctg ctgtaggtag tagtgacagc ttacctacag aagacccttt ctataatgcg       420
     actaaacaac agtgggccca caacttatta ggagaaatca aaaatgtagt ggataagatc       480
     gtgggagccg tagtgagact ggctggtaag ccaaccttac ttccaagaga tgggagtgtg       540
     cgctcttcaa tcgaaaaggt ggaaaaagaa ccagagaaac cctcacaaga ggagttagat       600
     aaagcagcgc ttttgaaaat ccaaacagag gttcaacgtt tatttgatct tggtacgaat       660
     ttaacaaacg cagattttga atctctatac cgcttgtcga agcagatttt cgatacggtt       720
     caaacatcca ctctttttat gggtggccag aaaacagatt ttatcaatga gctctcagca       780
     gaatatggca atgcagatca attagctcaa gtttttgcgg atggtcgtat tgagggatta       840
     aaagatgttc tcaatgtagt taaaaggaag ttaacagaag aagaatacag cattttctca       900
     gaagtagaaa aagcattagc gagtttgcaa acctcagtac acacctacga ccaagaaaaa       960
     tttgatctta tcgatcaaat cggagacgaa ttagcagata caattaatgc atctgcctta      1020
     tcgagaaatg ataaaatcga tttatgtgca cagatctcct atttatataa agatcaagta      1080
     tctgctgtag attcttttaa tgttgttgtt gatgcaacta ttttcgtcaa cagtcaccaa      1140
     gaggctattt tcgatcagat atctaattta gtatcctcct tgatgggggt atttgctcct      1200
     atcaacttag gacaagtgac tacggagatc agtagtgcgg ccatagccgg agcattacaa      1260
     gctgtccgtg caatcaattc taggttcaat gatctaacag atgcacaaca aaaattagtc      1320
     aatgatgctt ttaaaacact aacaacgttc aaagctccta gttatatagg ggcgatatgg      1380
     gcctattttg ttgcttcgac tgtattagct actaatacaa cagcttcaat ggagaatatt      1440
     ggtgctgtca taagagaagc ggcaaaagag atggggagct caaaacttga tatagcctcc      1500
     tctattaaga ctacaatgga gaacattgta tcagcaaatg ggcagtttaa accggggaat      1560
     actgataacg ggcaagaaga aacttataca atttattcac aacaaaacgg ctctggagta      1620
     aaaatcaatg cccagctttt aaatcgtgga aacgtaggat ttttacctaa aataacggtt      1680
     gcagccaacg cgcatgcaga aagtacagct agagcttatt tcgcatttaa aggactagct      1740
     ggagtacaaa tagcacaact ccaatctaag atagatgaat cccgagggca acttaaggat      1800
     tatcaagctt taaaggcaga gctctataag gatcaattat atgcacaatc taatgagctg      1860
     caagcgatgg cattaccttc agctgtggct tcggtattaa tcgatcgtta tatgcctaag      1920
     gaagtgggtt ttttaaatgg tatttacgat cagctgtact atagcaacct cggatcgtca      1980
     gttggaaatg caatgataga cgttatttcc gagtatgtga acgcggctac atatttcaat      2040
     tttgccagtt atgtgggtca gcaacctgct gtaggacaga aaggtaaaga tgtatttcct      2100
     ggaactgcgg atagcgcgag aaataaatta gaaacagaac gaaaaaaagc agctgcctat      2160
     cttaaaagta cgcaagatgc aaaaatagta ttggaagagc aggtaaaaag agtcactgaa      2220
     gattccaaaa tttcgaatga gcaacgtaca cgcatcatcg attctttaaa taactacaga      2280
     gataatttga atgtgatatc aggatcttta gtcttgttac aaaactattt agctccttta      2340
     ggtgtgagtg aaggtgaagt tgctggaacg tttcaagtta ccggtggaga agaacaatgg      2400
     caggcacgac tggagatttt agaagatgcg ttagtatctg ggttatcagg taatgctatc      2460
     agtgggggga tgttcccatt acaagctact atacaatcag atcagcagtc ttatgccgac      2520
     atgggacaga actaccagct agagttacaa atgcacctaa cgtctatgca gcaagaatgg      2580
     accgttgtcg cgacatcttt acaggtgtta aatcagatgt atctgagttt ggcaagaagt      2640
     ttgatgggca atttataa                                                    2658
//

If you have problems or comments...

PBIL Back to PBIL home page