(data stored in SCRATCH zone)

EMBL: CR848038.PE174

CR848038.PE174       Location/Qualifiers
FT   CDS_pept        185994..187106
FT                   /transl_table=11
FT                   /locus_tag="CAB174"
FT                   /product="conserved membrane protein"
FT                   /note="Similar to Chlamydia pneumoniae ct449 hypothetical
FT                   protein cpn0565 or cpj0565 or cp0185 SWALL:Q9Z7Y8
FT                   (EMBL:AE001641) (366 aa) fasta scores: E(): 2e-30, 32.05%
FT                   id in 365 aa. Only significant database prokaryotic matches
FT                   are to predicted Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB174"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63632"
FT                   /db_xref="GOA:Q5L6T9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6T9"
FT                   /protein_id="CAH63632.1"
FT                   /translation="MKLPRICFGYVPKLAFMCTKEKGNVHYIPTARHAAKKVVSGIFAV
FT                   LGTAAFSCSILAASMCQTFFPCIGLFILGILLFIVAYCQYGGAWTRIEIPKLRYRKPHV
FT                   SSITEREYLSLLWKWRFLSPSVYCHQVNRNIYICEGTKDNLKKILEKRSAKKNGTILIQ
FT                   ELDLDAIRHDQLETETQYQEVFQLPKAMLEGVKSFLRTSYSEDKIISASWPDHPPGPTP
FT                   QEVLYTHIPGLRQGDEAYESASLLSVYTETYIEAFKAAIERVAVSRLVSREGICLLVSP
FT                   LGVVKGLSPEALHATKTLSKTAFLQAVESLAMETVIPESKSRLRITIALVDPESVAPLR
FT                   SVDTNVMFPSRESLSFSDFSPASSTWCHVI"
     atgaaattgc ctcgaatatg ttttgggtat gtgcctaaac ttgcatttat gtgtacaaaa        60
     gaaaaaggca atgttcatta cattcctact gcacgccacg cagctaaaaa ggttgtttcg       120
     ggaatttttg ctgttttggg aacagcagcg ttttcctgta gtatactggc tgcgagtatg       180
     tgtcagacct ttttcccatg tatcggatta ttcatcctcg gcatcctctt gtttatcgtt       240
     gcgtattgcc aatatggagg agcgtggaca cgtatagaaa ttccaaaatt acgttatcgt       300
     aaacctcacg tttcttcgat aacagagaga gaatacctgt ctttattgtg gaagtggcgt       360
     tttctgtctc caagtgtata ctgtcatcaa gtaaatagaa atatttatat ctgtgagggg       420
     actaaggata atctaaaaaa aattttagaa aagagatcgg cgaaaaaaaa cgggacaatt       480
     ttaattcagg aactggattt agacgcaatt agacatgatc agttagaaac cgaaactcaa       540
     tatcaggaag tcttccaatt gcctaaagct atgctcgaag gggtgaaaag ctttttgaga       600
     acttcttatt ctgaggacaa aatcatttcc gcctcatggc cagatcaccc tccagggccc       660
     acgcctcaag aagttctgta tacacatatt cccggattgc gacagggtga tgaagcttat       720
     gagagtgctt ctttgctctc agtctataca gaaacatata ttgaagcttt caaagcagca       780
     atagaaagag tggcagtttc tcgtctggtg agtcgggaag gcatttgcct tttagtgtct       840
     cctttgggcg ttgtcaaagg tctaagtcca gaggctctac atgcaacaaa aaccctttct       900
     aaaaccgctt ttcttcaagc tgtagaatct ttagccatgg aaactgtcat ccccgaaagt       960
     aagtccagac ttcgaataac tatagctctt gttgatccag aaagtgtggc cccattaaga      1020
     tccgtagata ccaacgtgat gttcccaagt agagaaagtt tatccttctc ggatttttct      1080
     cctgcaagtt ctacctggtg tcatgtgatt taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page