(data stored in SCRATCH zone)

EMBL: CR848038.PE185

CR848038.PE185       Location/Qualifiers
FT   CDS_pept        203965..204915
FT                   /transl_table=11
FT                   /locus_tag="CAB185"
FT                   /product="putative exported protein"
FT                   /note="Similar to Chlamydia pneumoniae hypothetical protein
FT                   cpn0553 cpn0553 or cpj0553 or cp0199 SWALL:Q9Z7Z9
FT                   (EMBL:AE001639) (312 aa) fasta scores: E(): 1.2e-44, 41.39%
FT                   id in 302 aa."
FT                   /db_xref="EnsemblGenomes-Gn:CAB185"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63643"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6S8"
FT                   /protein_id="CAH63643.1"
FT                   /translation="MYYLCFFILITSFLTGHASPVASSEVFPWIAPKSLTVLGSPFIDV
FT                   ILETPKEFIEKCDVKVGEIQNINSSDIKKIFLMYRETFPENPITVTRKEPLSLTEDQLA
FT                   NLGCISLLNKPPYLHYGKQAEYGPALQAWDHLRLILRCPNQEDTFCYFLEETPKSLAEL
FT                   SLSSDVGYTLIDSDLLIYGCYIESFLKKARGPNHKILFDLNNPHIVQHYRDRVWSLLPY
FT                   IDVLFLSEESTKSLTGMSNASLGRRLLSHMIPTVFVQNTAEEKAQIYFIQHGKETVYSA
FT                   TQELQQIVLAFLFGYIHDNVIDYCFHAGDLLLEYA"
     atgtattatc tttgtttttt catattgata acttcttttt taacaggtca cgcttctcct        60
     gtggcctcct ctgaagtttt cccctggata gcaccgaaat ctcttaccgt gctcggtagc       120
     ccatttatcg atgtgatcct cgaaacccct aaggaattta ttgaaaaatg tgatgtgaaa       180
     gtaggtgaga tacaaaacat caacagctca gatataaaaa agattttttt gatgtatagg       240
     gaaacctttc ccgaaaatcc tatcacagta accaggaaag aacctctaag ccttacagaa       300
     gatcaactag ccaatctagg ttgtataagt ttattaaaca agccgcctta tcttcattac       360
     ggaaaacagg cagaatacgg gccagctctg caggcatggg atcatctccg actgattctt       420
     cgttgcccaa accaagaaga taccttctgc tattttcttg aagaaactcc caaatccttg       480
     gcagaactct ctttatcctc ggatgtggga tataccttga ttgatagcga tttattgatc       540
     tacggttgct acatagaaag ttttctaaaa aaagcacgcg gtcctaacca taaaatccta       600
     ttcgatctta acaatcctca tattgtccag cactatagag accgcgtttg gtctctgttg       660
     ccctatatcg atgttctctt tctatcagaa gagtcaacaa agtcgttaac agggatgtcg       720
     aacgcaagtt taggtagacg tttgctttcc cacatgattc cgaccgtgtt tgtacaaaat       780
     acagcagaag agaaggctca gatctatttt atccaacatg gtaaagaaac cgtgtattcc       840
     gccacacagg aattacaaca aatagtctta gcgtttctct tcggttatat tcacgataat       900
     gtcatcgatt attgttttca tgcaggggat ctcttgttag agtacgccta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page