(data stored in SCRATCH zone)

EMBL: CR848038.PE191

CR848038.PE191       Location/Qualifiers
FT   CDS_pept        complement(209514..210044)
FT                   /transl_table=11
FT                   /locus_tag="CAB191"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlamydia pneumoniae
FT                   2-c-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF
FT                   or cpn0547 or cp0205 SWALL:ISPF_CHLPN (SWALL:Q9Z805) (176
FT                   aa) fasta scores: E(): 3.4e-53, 76.57% id in 175 aa, and to
FT                   Escherichia coli, and Escherichia coli O157:H7
FT                   2-c-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF
FT                   SWALL:ISPF_ECOLI (SWALL:P36663) (159 aa) fasta scores: E():
FT                   1.2e-07, 29.11% id in 158 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB191"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63649"
FT                   /db_xref="GOA:Q5L6S2"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6S2"
FT                   /protein_id="CAH63649.1"
FT                   /translation="MNAENDSSLPKPQWIYRVGIGQDSHRFLSESSAKPCILAGVIFEN
FT                   SPGFQANSDGDIIFHAICNAISSVTHRIILGEVADELLHTRGITDSSVYLSEAIKSLKS
FT                   NQMISHAAITIEGNRPKFLPKLSAMRQSIASALNIPLGSVGITATSGEGLSDFGCGDGV
FT                   QCFCILTIMEYCG"
     atgaacgcag aaaatgactc ttccttgcct aaaccgcagt ggatttaccg tgtaggaatc        60
     gggcaagata gccatcgttt cctctctgaa agttctgcta aaccctgcat tttagctgga       120
     gttatctttg aaaatagtcc tggtttccaa gctaattctg acggggacat tattttccat       180
     gctatttgca atgctatttc ttctgtcacg catagaatta tactaggaga agtggctgac       240
     gagcttctcc atactcgtgg cattacagac agtagcgtgt atttatctga agctataaaa       300
     tctttaaaat cgaaccagat gatttctcat gcggccatta ctattgaggg aaatcgcccg       360
     aaattccttc caaagctctc tgcgatgcga caaagtattg cttcagcctt gaacattccc       420
     ttaggatctg taggcattac tgcgacttca ggagagggat tgagtgattt tggttgtggt       480
     gatggtgtgc aatgtttttg tatacttacc attatggagt actgcggtta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page