(data stored in SCRATCH zone)

EMBL: CR848038.PE194

CR848038.PE194       Location/Qualifiers
FT   CDS_pept        211784..212791
FT                   /transl_table=11
FT                   /locus_tag="CAB194"
FT                   /product="putative GTP-binding protein"
FT                   /note="Similar to Chlamydia muridarum GTP-binding protein,
FT                   Gtp1/Obg family tc0699 SWALL:Q9PJX7 (EMBL:AE002339) (335
FT                   aa) fasta scores: E(): 6.9e-98, 78.44% id in 334 aa, and to
FT                   Bacillus subtilis spo0b-associated GTP-binding protein ObG
FT                   SWALL:OBG_BACSU (SWALL:P20964) (428 aa) fasta scores: E():
FT                   3.6e-48, 42.81% id in 334 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB194"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63652"
FT                   /db_xref="GOA:Q5L6R9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6R9"
FT                   /protein_id="CAH63652.1"
FT                   /translation="MFLDQITIELRAGKGGNGVVAWRKEKYLPKGGPYGGNGGVGGSII
FT                   IESATHVYSFESYRNIRFLKAEDGRPGATNNRSGKNGKDLVLIVPEGTLLRDVETKEIL
FT                   YDFAKSGERLVVCRGGKGGKGNTFFKTSTNRAPTKATPGKPGEIRQVELELKLIADIGL
FT                   VGFPNAGKSTLFNTLARTEVKVGAYPFTTLQPVLGLVPCQEKLYQKPWIIADIPGIIEG
FT                   AHQNRGLGLDFLRHIERTRLLLFVIDICGCERSSPEEDLRILMDELVHYREDLADKNRI
FT                   IALNKIDDLLPDERQERLESFQKLFPSETFVLVSGLTGEGVDLLNSLFTNKLAV"
     atgtttttag atcagattac catagagttg cgtgctggaa aaggcggtaa cggtgttgtc        60
     gcttggagaa aggaaaaata tcttcccaaa ggtggcccct atggcggtaa cggtggtgtc       120
     ggtggatcta tcattataga gtcagctaca catgtgtact cttttgaatc ctatagaaat       180
     atacgctttt taaaagctga agacggacga ccaggagcca caaataaccg ctcgggaaag       240
     aacggtaaag acctcgtctt aatcgttccc gaaggaactt tactcagaga tgtagagact       300
     aaagaaattc tctatgactt tgctaaaagc ggagagcgtt tagtcgtttg tcgtggaggt       360
     aaaggaggta aggggaatac gtttttcaaa acgtctacaa accgcgctcc taccaaagcc       420
     actcccggca agcctggaga aatacgccag gtagagcttg agctcaagct gatcgctgat       480
     attggccttg tgggtttccc taatgcagga aaatctacat tattcaacac tcttgcaaga       540
     acagaagtca aggtcggggc ttatcccttc actacactgc aacctgtatt gggtcttgtt       600
     ccttgccagg aaaaattgta ccagaaaccc tggattatag cagatattcc cgggatcata       660
     gaaggagctc accaaaatcg tggtttaggg ctggatttct taagacatat tgagcgtacc       720
     agattattgt tgtttgtgat tgatatttgt ggatgcgaga gatcctcccc agaagaagat       780
     ctacgtattc ttatggacga gcttgtacat tatagagaag atctcgcaga caagaatcgg       840
     attatcgctt taaacaagat cgatgatctt cttcccgatg aaaggcaaga acgtctagaa       900
     agttttcaaa aactctttcc ttctgagacg tttgtattag tatccggact tactggagaa       960
     ggagtcgatt tactcaacag tcttttcaca aataaactag ccgtgtaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page