(data stored in SCRATCH zone)

EMBL: CR848038.PE214

CR848038.PE214       Location/Qualifiers
FT   CDS_pept        235769..236758
FT                   /transl_table=11
FT                   /locus_tag="CAB215"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlamydia muridarum hypothetical protein
FT                   Tc0679 tc0679 SWALL:Y679_CHLMU (SWALL:Q9PJZ7) (328 aa)
FT                   fasta scores: E(): 3.4e-89, 67.17% id in 329 aa and
FT                   Yersinia pestis arabinose 5-phosphate isomerase kdsd or
FT                   ypo3577 or y0149 or yp3832 SWALL:Q8ZB48 (EMBL:AJ414157)
FT                   (328 aa) fasta scores: E(): 1.3e-32, 35.22% id in 318 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB215"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63672"
FT                   /db_xref="GOA:Q5L6P9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6P9"
FT                   /protein_id="CAH63672.1"
FT                   /translation="MRSPTTSIDLCQDIVSKQRESLERFFGAFQCEDTWVLAEKILHHQ
FT                   GSIFFSGVGKSGCIARKIVATLQSFGEHALFLASGDLLHGDLGVVRPGDIVCLFSKSGE
FT                   TRELLECIPYLKERGVFIAGITSATYSSLAVLCDHVVILPMIEELDPFNLVPTTSTTCQ
FT                   LLFGDLLAITLLRSRQISLADYGKNHPGGQIGLKVIGKIRDYMFLKTEVPFCSPEDTIA
FT                   DSLDIFSSYGCGCVCIVNEKFEILGIFTDGDLRRALARHGGDILSQRLQDVMTPNPRVI
FT                   SEDADVLLGLQMMETGSPVTILPVVDAKDQKYVVGLLQMHTLAKAGLI"
     atgcgctctc ccacaacatc tattgatcta tgccaagata ttgtcagtaa gcaaagggaa        60
     tctttagaac gtttttttgg tgcttttcag tgtgaggata cttgggtatt agctgagaag       120
     atattacatc accagggttc gatatttttt tctggtgtag gaaaaagtgg ttgtatcgca       180
     aggaaaatcg tcgctacttt acagtctttt ggagagcacg ctcttttcct agcttctggc       240
     gatctcctac acggggatct tggcgttgtt cgtcctggag atatcgtctg tcttttttct       300
     aagagtggag aaactcgcga gcttttagaa tgtatccctt atttaaagga gcgaggcgta       360
     tttattgcag gaattacctc agcgacttat tcgagtttag ccgttctttg tgatcacgtc       420
     gttatcttac ctatgatcga agaattagat ccttttaatc ttgtgcctac aacatcaacg       480
     acatgccaac tactttttgg tgatctttta gcgattactt tattgcgtag tcggcaaatc       540
     tctctcgctg attacgggaa gaaccatcca ggcggtcaga ttggtcttaa ggttattggt       600
     aaaattcggg attatatgtt cctaaaaaca gaagttcctt tttgttctcc tgaagacacc       660
     atcgcagatt ctttggacat cttttcttct tatggttgtg gctgtgtgtg tatagtgaac       720
     gagaagtttg aaatattagg gatcttcaca gatggagatt tacgcagagc attagcgcgt       780
     catggaggcg atattctctc tcagagactt caagatgtca tgacaccaaa tcctcgagtg       840
     attagtgaag atgctgatgt gcttcttggc ttacaaatga tggaaacagg gagtcctgtg       900
     accattttac ccgtagtaga tgctaaggat cagaagtatg tggtaggatt gcttcagatg       960
     cataccttgg caaaagcagg tctcatctaa                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page