(data stored in SCRATCH zone)

EMBL: CR848038.PE228

CR848038.PE228       Location/Qualifiers
FT   CDS_pept        complement(250046..251170)
FT                   /transl_table=11
FT                   /locus_tag="CAB230"
FT                   /product="putative exported protein"
FT                   /note="Similar to several proteins of undefined function
FT                   including: Chlamydia pneumoniae CBS domain protein tlyc_2
FT                   or cpn0510 or cp0244 SWALL:Q9Z842 (EMBL:AE001636) (387 aa)
FT                   fasta scores: E(): 4.2e-81, 61.24% id in 387 aa and to
FT                   Chlamydia muridarum hemolysin, putative tc0706 SWALL:Q9PJX0
FT                   (EMBL:AE002339) (374 aa) fasta scores: E(): 6.5e-68, 53.74%
FT                   id in 374 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB230"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63686"
FT                   /db_xref="GOA:Q5L6N5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6N5"
FT                   /protein_id="CAH63686.1"
FT                   /translation="MLYSLLAITLLFLLFSTALSQKTNTSQENTDTPQREPKQSHTPAL
FT                   LAAVLLSFYGILGVALYSQYTWKTKSLSLVFWATYILAAPLAYGCLPYCIKLHKGTHSA
FT                   LCFISSLLQAFFLPLQRYMHRRDEQSKTGNSEMENQLSEAVSSFDKLIVREIMIPKVDI
FT                   FAIQEDTPIRNAFPAIIEEGYSRIPLYKKNIDNITGVLLVKDLLAIYPKSVNSSLPVSS
FT                   VAKPPLYAPEIKKVSSLLQEFRQKHRHLAIIVNEYGITEGIVSMEDIIEEIFGEIADEY
FT                   DVQEDIPYKKVGNSWIVDGRMNISDAEEYFNLKIHHENSYDTLGGHVFHKVGAVPQKGM
FT                   KIHHENFDIEIITCSERSVGKLKITPRKKKLSPS"
     atgctttatt ccctactcgc cattactctc ctctttcttt tgttctccac ggcactgtct        60
     cagaagacaa acacctcaca agaaaatact gacacacctc agcgagaacc taaacagtcg       120
     catacccccg ctcttctcgc tgccgtacta ctcagttttt atggaattct aggcgttgcc       180
     ctctactccc aatacacatg gaaaaccaaa agtctatctt tggttttttg ggcaacatat       240
     atactcgctg cccccttggc ttacggctgt cttccctatt gtatcaaact tcacaaagga       300
     acacattcag ctctctgttt tatctcctcg ttacttcagg cgttttttct acccctccaa       360
     cgctatatgc accgcaggga tgagcagtct aaaacaggca actcagaaat ggaaaatcaa       420
     ctctctgagg ccgtatcgtc atttgataag ttgattgttc gagaaatcat gatccctaag       480
     gtagatatct tcgccattca agaagacacc cccatccgta acgcttttcc cgcaatcata       540
     gaagaagggt atagccgcat tcctctatac aagaaaaaca ttgataatat caccggagtc       600
     ctcctagtca aagatctact cgccatctac cctaaatccg taaactcttc actccctgtt       660
     tcttcagttg ctaaacctcc cctctatgcc ccggaaatta aaaaggtgtc ctcattactc       720
     caagaatttc gtcagaaaca tcgccacctc gccatcatcg tcaacgaata cggtatcact       780
     gagggcatcg tcagcatgga agatatcatt gaagaaattt tcggagaaat tgccgatgaa       840
     tatgatgtgc aagaagatat tccctataaa aaagtaggga actcttggat cgtagatgga       900
     cgtatgaaca tctccgatgc cgaagaatac tttaatctca agatccacca tgaaaatagc       960
     tacgacacac taggaggaca cgtttttcat aaagtcggtg ctgttccaca aaaagggatg      1020
     aaaatccatc acgaaaactt tgatatcgag attatcacct gctcagaacg cagcgtaggt      1080
     aaactcaaaa tcaccccaag aaaaaagaag ttatctcctt cgtaa                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page