(data stored in SCRATCH zone)

EMBL: CR848038.PE229

CR848038.PE229       Location/Qualifiers
FT   CDS_pept        complement(251172..251648)
FT                   /transl_table=11
FT                   /locus_tag="CAB231"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to several including: Chlamydia pneumoniae
FT                   predicted metalloenzyme cpn0509 or cpj0509 or cp0245
FT                   SWALL:Q9Z843 (EMBL:AE001636) (158 aa) fasta scores: E():
FT                   5.2e-37, 61.78% id in 157 aa, and to Chlamydia muridarum
FT                   hypothetical protein Tc0705 tc0705 SWALL:Q9PJX1
FT                   (EMBL:AE002339) (161 aa) fasta scores: E(): 1.7e-32, 62.66%
FT                   id in 150 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB231"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63687"
FT                   /db_xref="GOA:Q5L6N4"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6N4"
FT                   /protein_id="CAH63687.1"
FT                   /translation="MKKVPLQVCVSNKQCDVPIRIQSVKKLVLCCLQCWKVSTDQVYVY
FT                   FLDDEALAQLHDEVFADPSLTDTITLPIDSPESTAHPHILGEAFISPKAAIRFLQDRAE
FT                   DTDLLYEEISRYVVHSLLHMLGYDDQTPEERKKMRGKENQALCMLREKHALLSD"
     ttgaaaaagg ttcctttaca agtttgtgtt tctaacaagc aatgtgatgt tcctattcgg        60
     atacaatcag taaaaaagtt ggttctttgc tgcttgcagt gctggaaagt ttccacagat       120
     caagtgtatg tgtacttttt agatgacgaa gctctggccc agcttcacga tgaggtgttt       180
     gcagatcctt cattaacaga tacgattaca ctacctatag attctccaga aagtactgcg       240
     cacccacaca ttcttggcga agctttcatc agtcctaaag cagccatacg ttttttacaa       300
     gaccgtgctg aagataccga cctactatac gaagaaattt ctcgctacgt tgtccattct       360
     ctcttacaca tgctcggata tgatgatcaa actcccgagg aaagaaaaaa aatgagaggt       420
     aaagaaaatc aagcgctatg tatgttgaga gaaaaacacg cgcttttatc agattaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page