(data stored in SCRATCH zone)

EMBL: CR848038.PE249

CR848038.PE249       Location/Qualifiers
FT   CDS_pept        272528..274144
FT                   /transl_table=11
FT                   /locus_tag="CAB251"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlamydia pneumoniae ct384 hypothetical
FT                   protein cpn0487 or cpj0487 or cp0267 SWALL:Q9Z864
FT                   (EMBL:AE001634) (543 aa) fasta scores: E(): 2.6e-125,
FT                   58.17% id in 538 aa, and to Chlamydia muridarum
FT                   hypothetical protein Tc0663 SWALL:Q9PK10 (EMBL:AE002334)
FT                   (526 aa) fasta scores: E(): 6e-92, 48.68% id in 534 aa.
FT                   Only significant full-length database matches are to
FT                   Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB251"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63707"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6L4"
FT                   /protein_id="CAH63707.1"
FT                   /translation="MRQHLLIGDFPRAIQEAQALLSSSECSLSTTRLALKALARGKDYD
FT                   SWNRGFTKARQCYPQLAKDRDTLEDFAQQVLSDGMRHPSMTVRAVSILSIGLARDFRLV
FT                   PLVLASLSDDSVIVRTLGLQVVLQYGSQSLKDAVCKIARHDDSMQVRMIAYQIAAILDI
FT                   EELLPYLQERANNKLVDGEERREAWKASLMLTPHGLSKSRVHEDMDQALFACELLHHLG
FT                   EEKEESVLLDLLSIRYPEVQEAALRAALSCGREVSCESKKIADQVHAMAQTSPFPKVRL
FT                   QAAALLYLQGDPLGEDLLVQGLLSPLASICESASAAVCSLGIGGKDLADKYLHRVVSRK
FT                   AAANLAILLLVSRTHVERAGDVIADFISDPEMCWAIEQFLWSSQWNPKSASLPLYFDMV
FT                   KREIGRKLIRLLAVAKYSKVKKVTGDFLSNRQQHGWSFFSGVFWEEGDEHTAQIWTADK
FT                   SFASKLESTLARLCQKKNSESLHQAIELYPESRWQDKLAILEGIAFSENLEGVDFLLEC
FT                   CSHETPSLRCAAAGAVFALFK"
     ttgcgtcagc atttgcttat tggtgatttc cctcgagcta ttcaggaagc tcaggccctt        60
     ttgtcctctt ccgaatgttc gctctccaca acccgacttg ccctaaaagc cttagcccga       120
     gggaaggatt acgactcctg gaatcgaggg tttactaaag ctcgtcaatg ctacccgcaa       180
     ctagctaaag atcgcgatac cttagaagat tttgctcaac aagtgctttc ggatggtatg       240
     cgccatcctt caatgacggt acgcgcagtg agtatactgt ctataggctt agctagagac       300
     tttcgtttag tccctcttgt tttagcgagt ctgtctgatg atagcgtgat tgtgcgtacc       360
     ctgggcctac aggtcgtctt gcagtatgga tctcagagtt taaaagatgc tgtctgtaaa       420
     attgcgcgcc acgatgattc tatgcaagtg cgtatgatag cctaccaaat tgctgcgatt       480
     ttagatattg aagaactcct tccttatctt caagaacgtg caaataacaa acttgtcgat       540
     ggtgaggaac gtcgggaggc gtggaaagct tctctcatgc tgaccccaca tgggctgtct       600
     aaatctagag tacacgaaga tatggatcag gctttatttg cctgcgaact cttgcatcat       660
     ttgggagaag aaaaagagga gagtgtgctc ctagatttat tatctattcg gtacccggaa       720
     gttcaagaag cagcattacg cgcagccttg tcttgtggac gtgaggtgag ctgtgaatca       780
     aaaaaaattg ctgatcaagt gcacgccatg gctcaaacgt ctcccttccc taaagtccgt       840
     ctacaggcag cagctcttct ctatcttcaa ggagatcctt taggggaaga tttgctagtg       900
     caaggtttac tttctcctct cgcctcgatt tgtgagtcag catctgctgc cgtatgttct       960
     ttaggtatag gcggaaaaga tcttgctgat aagtatctgc atcgtgtggt ctccaggaag      1020
     gccgcagcaa atctcgcgat tttactgctt gtcagtcgta cgcacgtgga aagagctggt      1080
     gatgttatag cggattttat cagtgatcct gagatgtgct gggcgatcga acagtttctt      1140
     tggagttcac aatggaaccc taaaagtgct tctctgcctc tctattttga tatggtaaaa      1200
     agagagatag ggagaaagct gatccgtttg cttgcggtag caaaatatag taaagtcaaa      1260
     aaagtgacgg gagattttct ttctaatcgg caacaacatg gctggagttt tttttcagga      1320
     gtattctggg aagaagggga tgaacacacg gcgcagatat ggactgcaga taaaagtttt      1380
     gcttctaagt tagagtccac gttagctagg ttgtgtcaga aaaaaaatag cgaatctttg      1440
     catcaagcta tagagctcta tcctgaaagt cgttggcaag ataaacttgc tattttagaa      1500
     ggtatcgctt tttcggaaaa tctcgagggc gtggatttcc ttctggaatg ttgttcccat      1560
     gaaacccctt cgctgcgttg tgcagccgca ggggctgtat ttgctctatt taagtag         1617
//

If you have problems or comments...

PBIL Back to PBIL home page