(data stored in SCRATCH zone)

EMBL: CR848038.PE254

CR848038.PE254       Location/Qualifiers
FT   CDS_pept        280899..281663
FT                   /transl_table=11
FT                   /locus_tag="CAB256"
FT                   /product="membrane transport protein, solute binding
FT                   component"
FT                   /note="Similar to many aminoacid transprot proteins
FT                   including: Escherichia coli arginine-binding periplasmic
FT                   protein 2 precursor ArtJ or b0860 SWALL:ARTJ_ECOLI
FT                   (SWALL:P30860) (243 aa) fasta scores: E(): 1.8e-15, 30.63%
FT                   id in 222 aa and to Chlamydia pneumoniae arginine
FT                   periplasmic binding protein ArtJ or cpn0482 SWALL:Q9Z869
FT                   (EMBL:AE001633) (259 aa) fasta scores: E(): 1.2e-62, 62.05%
FT                   id in 253 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB256"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63712"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6L0"
FT                   /protein_id="CAH63712.1"
FT                   /translation="MKQWISCLRILFFGCCLLLVGCNSSVKRDKIWLVGTNATYPPFEF
FT                   IDKHGNTIGFDIDLAEAISQRLGKELKVVEFSFDALILNLKKHRIDAVLAGMSITPSRQ
FT                   KEIAMLPYHGEGIHELTIVSRQPISKDDVLPLSKYSSVAVQTGTFQEDYLLSLPGVCVR
FT                   SFDSTLEVLMEVGCKKSPIAVLEPSVAHVVLKEFPDVYTTTVDLPEDQWVLGCGLGIAK
FT                   DRPEHVKEVQNVLEELRADGTLLKLEKKWGLH"
     atgaaacagt ggatttcttg ccttagaatc ttgtttttcg ggtgttgttt actcttagtt        60
     ggttgcaatt cttctgttaa gagagataaa atttggctag taggtacgaa tgcgacttac       120
     cccccctttg aatttattga taaacatgga aacaccattg gttttgatat agatcttgcc       180
     gaagccatta gccaaagact tggtaaagaa ttgaaggtgg tggagttctc ttttgacgcg       240
     ttgattctca atttaaagaa acatcgcata gatgcggttc tagcagggat gtccattaca       300
     ccctcgcgtc aaaaagaaat tgctatgctt ccctatcatg gagagggcat ccatgagctc       360
     acgattgtat ctagacagcc tataagtaaa gatgatgttc ttcctttgtc taagtattct       420
     tcagtagctg tacaaacggg gactttccaa gaggattacc tgctgtcttt acccggagtc       480
     tgtgtccgtt cttttgatag cactttagag gttctaatgg aggtggggtg taagaagtcc       540
     ccaatcgctg tgcttgagcc ttctgtggcg catgtggtac tgaaagagtt tccagatgta       600
     tatacaacaa ccgtagactt acctgaagat cagtgggttt tagggtgcgg cttaggtata       660
     gcaaaagatc gccctgagca cgtgaaagaa gtccaaaacg tgttggagga actgcgagca       720
     gacggaaccc tcctaaaatt agaaaaaaaa tggggattac attaa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page