(data stored in SCRATCH zone)

EMBL: CR848038.PE284

CR848038.PE284       Location/Qualifiers
FT   CDS_pept        339749..340180
FT                   /transl_table=11
FT                   /locus_tag="CAB292"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Chlamydia pneumoniae HTH transcriptional
FT                   regulator YfgA or cpn1069 or cp0781 SWALL:Q9Z6J0
FT                   (EMBL:AE001687) (143 aa) fasta scores: E(): 8.6e-46, 82.51%
FT                   id in 143 aa, and to Chlamydia trachomatis HTH
FT                   transcriptional regulator YfgA or ct009 SWALL:O84012
FT                   (EMBL:AE001275) (143 aa) fasta scores: E(): 7.3e-40, 73.42%
FT                   id in 143 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB292"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63742"
FT                   /db_xref="GOA:Q5L6I3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6I3"
FT                   /protein_id="CAH63742.1"
FT                   /translation="MAEQIHKELLHLGEVFRTKREEQSLSLKDVEAATSIRYSCLEAIE
FT                   NGYLGKLISPIYAQGFIKKYAAYLGLDGERILQDHPYVMKIFKEFSEHNMEMLLDLESM
FT                   GGRNSPEKAIRSLSNLWWAGLIVFSGMAIWWLGSLLSLF"
     atggcagaac aaattcataa agagctctta catttaggag aggtgtttcg cacaaaacgc        60
     gaagaacagt ccttatcttt aaaagatgta gaagcagcga catccatacg ttactcctgt       120
     ttagaagcta tagaaaacgg ctatttaggc aagctcatct ctcccattta cgctcaggga       180
     tttatcaaga aatatgccgc ctacttaggg ctagatggcg agcgcattct ccaagaccat       240
     ccttatgtta tgaaaatctt caaagaattt tcagagcata atatggagat gctgctagat       300
     ttagaatcta tgggagggag aaattcccca gaaaaagcca ttcgtagttt gtctaatctt       360
     tggtgggctg gacttatcgt cttcagtggt atggcgattt ggtggttggg atccctactt       420
     tctcttttct aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page