(data stored in SCRATCH zone)

EMBL: CR848038.PE286

CR848038.PE286       Location/Qualifiers
FT   CDS_pept        complement(341877..343205)
FT                   /transl_table=11
FT                   /locus_tag="CAB294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAB294"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63744"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6I1"
FT                   /protein_id="CAH63744.1"
FT                   /translation="MCCPGISMSCRSSQDAYEEETMSLNGITKQPGSTSEFNLKVGDPS
FT                   LLDTIRAAGDLVSDALNSARIQRTSQFCQDSCRPWCADNCWSPFLCFFDCLCTCMITPD
FT                   ENLGSEAKYDDLTDFIQQQRDEFGPICVGIAMKNGPWDISKLLAEGFTLSAEQKTLFSE
FT                   KCEEAKNQLGRCLKGGSQQELFKVANAAHQLPSKGSTELENVKNSLEESINISTPPSLP
FT                   TCLILYPSESHDTAAHEQRSGYSLNIQRLQHQLSQLEVLDMNSQTTGFLGFQARAAVNI
FT                   LLLTLNKYVNEEKNIFDHPGFGLSIEESKYRTLLLLSLLALGFVPLGAEQEVPTSLEQL
FT                   ENTSKELRTKEKHTPVSSVDSRSFGTEVKVNAGTLHPLPKYRQRVVLNGRLTENAGTSC
FT                   VDGVTPGDTSGAHLWDFTNPKSQEALLKTAKNITAMTSSLFLR"
     atgtgctgcc ctggaattag catgagctgc cgctcaagtc aagatgccta tgaagaagaa        60
     actatgtctt taaatgggat tacaaaacaa cctggatcca cttcagaatt taatttaaaa       120
     gtgggtgatc cgtcattact agataccatt cgtgctgctg gagaccttgt ctctgatgct       180
     ttaaattctg caagaataca acgcaccagc caattctgcc aagattcttg caggccttgg       240
     tgtgcagaca attgctggag tcctttcctc tgtttcttcg attgtctttg tacctgcatg       300
     attactcctg atgaaaatct aggatctgaa gcaaaatacg atgatttaac tgattttatc       360
     caacagcaaa gagatgagtt tggtcctatt tgcgttggta tcgcaatgaa aaacggccct       420
     tgggatattt ctaaactact cgcagaaggt tttactttat ctgcagagca gaaaacgcta       480
     ttttcagaaa aatgtgaaga agcaaaaaat cagttaggta gatgcttaaa aggaggctct       540
     caacaagaac tcttcaaagt tgctaatgct gcgcatcaac ttccttcaaa aggttctaca       600
     gagctagaaa atgtgaaaaa ctctttagaa gagtctatca acatctcaac tcctccttct       660
     cttcccacat gtttaattct ttatccttct gaaagccatg acacagctgc tcatgaacaa       720
     agatctgggt actctctgaa tatccaaagg ttacagcacc aacttagcca actagaagtt       780
     ttagatatga attctcaaac gaccggtttc ttaggatttc aagctcgggc tgctgtaaat       840
     attttgttac tcactttaaa taagtatgta aatgaggaga aaaatatctt tgatcaccca       900
     ggatttggat tgagcatcga agaatcaaaa taccgtactt tacttcttct ttccttacta       960
     gctttaggtt ttgttccttt aggtgcagaa caagaggtcc ctacgtcttt agaacaacta      1020
     gaaaatacaa gtaaagaact tcgtacaaaa gagaaacata cgcctgtatc ttctgtagat      1080
     tcacgatctt tcggaacgga agtcaaagtc aacgcaggaa cactccatcc tctgcctaaa      1140
     tacagacaaa gagttgttct taacggtcgc ttgactgaaa atgctggaac atcgtgtgtt      1200
     gacggggtca cacctggaga cacaagtggt gctcaccttt gggatttcac aaatcctaaa      1260
     tctcaagaag ctcttctcaa aacggctaaa aacatcacag ctatgacttc aagtctattt      1320
     ttaagataa                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page