(data stored in SCRATCH zone)

EMBL: CR848038.PE302

CR848038.PE302       Location/Qualifiers
FT   CDS_pept        complement(361092..361682)
FT                   /transl_table=11
FT                   /locus_tag="CAB310"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to many Maf and Maf-like proteins: Bacillus
FT                   halodurans septum formation protein Maf or bh3033
FT                   SWALL:MAF_BACHD (SWALL:Q9K8H3) (190 aa) fasta scores: E():
FT                   1.7e-19, 41.08% id in 185 aa and to Chlamydia trachomatis
FT                   Maf-like protein Ct349 ct349 SWALL:Y349_CHLTR
FT                   (SWALL:O84353) (196 aa) fasta scores: E(): 2.1e-41, 53.57%
FT                   id in 196 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB310"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63760"
FT                   /db_xref="GOA:Q5L6G5"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6G5"
FT                   /protein_id="CAH63760.1"
FT                   /translation="MEPKFILGSSSPRRKLILEYFRIPFTCIPSNFEEHSVPYHGDPVA
FT                   YSQELAIGKAESIVKDHNPEGLILTADTVVAYQGKIFNKPGSYDEAIEMLKTLSGQTHA
FT                   VITSIALLQDRKLVTGEETTQVTFTQLPEAYLGRYIKAFSTLDKCGAYSIQEGGSLIIH
FT                   NIQGCAYNVQGLPIKTLKHLLLEFNVDLWDYLV"
     atggaaccaa agttcatcct gggttcttct tctccacgaa gaaaattgat attagaatac        60
     tttcgtattc cttttacctg tattccctcg aattttgaag aacattcggt tccctatcat       120
     ggtgatcctg tagcgtattc tcaagaattg gctataggta aagccgagtc tatagtcaag       180
     gaccacaatc ctgaaggtct cattcttact gcggataccg ttgtggcgta tcaggggaaa       240
     attttcaata agccgggttc ttatgatgag gctattgaaa tgttaaaaac attaagcggt       300
     caaacccatg ccgtaattac aagtatcgcg cttttgcaag ataggaaatt agtaaccgga       360
     gaagagacca cacaggtaac atttacccaa ctacccgagg cgtacctggg aaggtatatc       420
     aaagcatttt ctaccctaga caaatgtgga gcctacagta ttcaagaagg cggcagcttg       480
     attattcata atatccaagg atgtgcatat aatgtccaag gtcttccgat taaaacactg       540
     aaacatctct tgttggagtt caacgttgac ttatgggatt atctcgttta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page