(data stored in SCRATCH zone)

EMBL: CR848038.PE311

CR848038.PE311       Location/Qualifiers
FT   CDS_pept        371541..373577
FT                   /transl_table=11
FT                   /locus_tag="CAB319"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar to over the whole range to Chlamydophila
FT                   caviae 2-oxoisovalerate dehydrogenase, e1 component, alpha
FT                   and beta subunit pdha/pdhb or cca00324 SWALL:Q823T1
FT                   (EMBL:AE016995) (678 aa) fasta scores: E(): 0, 92.77% id in
FT                   678 aa. Also similar in parts to many including Bacillus
FT                   subtilis 2-oxoisovalerate dehydrogenase beta subunit
FT                   SWALL:ODBB_BACSU (SWALL:P37941) (327 aa) fasta scores: E():
FT                   1.2e-53, 47.07% id in 325 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB319"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63769"
FT                   /db_xref="GOA:Q5L6F6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6F6"
FT                   /protein_id="CAH63769.1"
FT                   /translation="MVAIQHELGSSIKEVLKLVWSLRFAENKMLLLSRQSDSGGTFQLS
FT                   CAGHELVGVVAGKSLLRGKDWSFPYYRDQGFPVGLGCDLSEIFASFLGRLAPNHSSGRM
FT                   MPYHYSHKKLRICCQSSVVGSQFLQAAGRAWAVKHTKSNEVVYVSGGDGSTSQGEFHEM
FT                   LNYVALHKLPLVTVVQNNAWAISVPFKDQCSTDLVRLGESYQGLSVYEVDGGDYFKLVD
FT                   TFSKAVDQARHTSVPALILVDVMRLEPHSNSDNHEKYRSREDLDHCKSHDPLIRLERLM
FT                   IDECGISPAEILDIKAEAEAEVTRACEIAEGMPFPSKGSTSHDVFSPHTTSLIDYENSL
FT                   EAQRLRDTQPKVMRDAITEALIEEMSRDSGVVVFGEDVAGDKGGVFGVTRNLTDRFGSE
FT                   RCFNTPLAEATIIGTAIGMAMDGIHKPVAEIQFADYIWPGINQLFSEASSIYYRSAGEW
FT                   EVPLVIRAPCGGYIQGGPYHSQSIEAFLAHCPGIKVAYPSNAADAKALLKAAIRDPNPV
FT                   VFLEHKALYQRRIFSACPVFSSDYVLPFGKAAITQVGSDLTIVSWGMSLVMSMEVAKEL
FT                   AALDISAEVIDLRTIVPCDFSTVIESVKKTSKLLIAHEASEFCGFGAELAATVAEQAYA
FT                   YLDAPIRRVAGLHAPVPYSKILENEVLPQKEKIFQAAKSLAEF"
     atggtagcaa tacagcatga attaggatct tcgattaaag aagttctgaa attggtctgg        60
     agtttaagat ttgctgaaaa taagatgctc cttctttccc gccagagcga ttctggagga       120
     actttccagt tgtcttgtgc tggtcacgag cttgttggag tggtggccgg gaaaagtctc       180
     cttcgaggga aggattggtc tttcccatat tatagggatc aaggattccc tgtaggtcta       240
     gggtgtgatc tttctgagat ttttgcttcc tttcttgggc gattagctcc gaaccattct       300
     tctggtagga tgatgcccta ccactattct cataaaaaac tccgtatttg ttgccaatcg       360
     agtgtagtag gttcccaatt tcttcaggca gcggggcgcg catgggctgt aaaacatacc       420
     aaatctaacg aagtcgttta cgtctctgga ggggatggat ccacttctca aggtgaattc       480
     cacgagatgt taaactatgt tgcgttgcat aagttgccct tagtcaccgt cgtacagaat       540
     aatgcttggg cgatctccgt gccttttaaa gatcagtgtt ctacagattt agtgcgttta       600
     ggggagagtt atcaaggtct ctctgtttat gaagttgatg gcggggatta ctttaagctt       660
     gtagatactt tttctaaagc tgtagatcaa gctagacata cctcggttcc tgcgttaatt       720
     ctagtcgatg ttatgcgttt agagccgcat agcaactctg ataatcatga gaaatatcgc       780
     agtcgtgaag atttagatca ttgtaagagt catgatcctt taatccggtt agaacggctg       840
     atgatagacg aatgcggcat ttcacctgcg gagattttag acataaaagc agaggctgaa       900
     gccgaagtca ctcgtgcttg tgaaatcgct gaggggatgc ccttccccag taaaggttct       960
     acgagccatg atgtattttc tccacataca acttctttaa ttgattatga aaattcttta      1020
     gaagctcagc gtttgcgtga cactcaaccc aaagttatgc gagatgccat tacagaagcg      1080
     ctcattgaag aaatgagccg agattctggt gtggttgttt tcggtgaaga cgtggctgga      1140
     gataaaggtg gggtttttgg tgtcactaga aatcttacag ataggtttgg cagcgaacgt      1200
     tgttttaata caccgttagc agaggctacc attataggca cagctattgg tatggcgatg      1260
     gatgggatcc ataagcctgt tgctgagatt cagtttgctg attatatctg gcccggcatt      1320
     aatcaattat tttctgaagc ttcgagtatt tactaccgtt ctgctggtga gtgggaagtg      1380
     cctttagtta ttcgtgctcc ttgtggaggt tacatacaag gtggccctta ccattcacaa      1440
     agtatagaag cgttcttagc ccattgcccg ggcatcaagg tggcttatcc atccaatgcc      1500
     gcagatgcaa aagccttgtt aaaagcggcg attcgcgatc ctaaccctgt ggttttttta      1560
     gaacacaagg cgctgtatca acgacgtatt tttagtgcgt gtccggtatt ttcttcggat      1620
     tatgttttgc cttttggtaa agcagcgatc acgcaagtcg gttcagattt gaccattgtt      1680
     tcttggggaa tgtctttagt tatgagtatg gaagtagcta aggaattggc agctttagat      1740
     atttctgcag aggttataga tttacgtacg atagtacctt gtgatttttc tactgttata      1800
     gagtctgtta agaaaactag taagttactt atagctcatg aagcgtcgga gttttgtggg      1860
     tttggtgcag agcttgctgc aactgtagca gagcaagcat atgcatacct agatgcacct      1920
     attaggcgtg ttgcgggatt acatgcccca gttccttact caaaaatact ggaaaacgaa      1980
     gttctccctc agaaggagaa aatctttcaa gcagcgaaga gtttagccga gttttaa         2037
//

If you have problems or comments...

PBIL Back to PBIL home page