(data stored in SCRATCH zone)

EMBL: CR848038.PE317

CR848038.PE317       Location/Qualifiers
FT   CDS_pept        complement(378939..379229)
FT                   /transl_table=11
FT                   /locus_tag="CAB326"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to many proteins of undefined function
FT                   including: Chlamydia pneumoniae upf0233 hypothetical
FT                   protein cpn0039/cp0376/cpj0039 cpn0039 or cp0736 or cpj0039
FT                   SWALL:Y039_CHLPN (SWALL:Q9Z9E2) (96 aa) fasta scores: E():
FT                   1e-29, 83.33% id in 96 aa, and to Rhizobium loti
FT                   hypothetical upf0133 protein Mlr5504 mlr5504
FT                   SWALL:YJA4_RHILO (SWALL:Q98BM7) (107 aa) fasta scores: E():
FT                   4.1e-05, 30.33% id in 89 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB326"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63775"
FT                   /db_xref="GOA:Q5L6F1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6F1"
FT                   /protein_id="CAH63775.1"
FT                   /translation="MGSGYAKKKKEAKMMEQQFLEMEASLEKKHYEGQAGNGLVSIVIN
FT                   GKCDIVSVKVQPTCLDPEDPEVIEDLFHSAFKEAKEAMDKELSVMRASMPF"
     atgggaagtg ggtatgcaaa aaagaaaaaa gaagcaaaaa tgatggagca acagtttcta        60
     gagatggaag cttctttaga gaaaaagcac tatgaaggac aagccggtaa tggactggtc       120
     tccatagtga tcaatggtaa atgtgatatt gtctctgtca aggtacagcc tacctgtctt       180
     gatcctgaag atcctgaagt tattgaagat cttttccatt cagcatttaa agaggctaaa       240
     gaggcgatgg acaaagaatt gtctgtaatg cgtgccagca tgccttttta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page