(data stored in SCRATCH zone)

EMBL: CR848038.PE327

CR848038.PE327       Location/Qualifiers
FT   CDS_pept        388519..390324
FT                   /transl_table=11
FT                   /locus_tag="CAB336"
FT                   /product="putative phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="Similar to Mycoplasma pirum phosphomannomutase ManB
FT                   SWALL:MANB_MYCPI (SWALL:P47723) (544 aa) fasta scores: E():
FT                   1e-39, 31.31% id in 546 aa and to Chlamydia pneumoniae
FT                   phosphomannomutase MrsA or cpn0056 SWALL:Q9Z9C5
FT                   (EMBL:AE001591) (598 aa) fasta scores: E(): 2.7e-148, 64.2%
FT                   id in 595 aa, and to Streptococcus thermophilus
FT                   phosphoglucomutase PgmA SWALL:Q9K560 (EMBL:AJ243290) (572
FT                   aa) fasta scores: E(): 2e-60, 37.2% id in 559 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB336"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63785"
FT                   /db_xref="GOA:Q5L6E1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6E1"
FT                   /protein_id="CAH63785.1"
FT                   /translation="MQHLQKKIEALCSPITTKNILTWLSNDCNEQDKDTIAELLNNDPK
FT                   RLEELFGMTLSFGTGGLRSPMGLGTNRINVFTIRRATQGLAQVLKKHHPHSGDLIRVVV
FT                   GYDTRHNSFDFAQETAKVLAGNNIHVLLFKHPEPLALVSFTLRAERALAGVMITASHNP
FT                   PEYNGYKVYMASGGQVLPPWDQEIMHASAHIEEIAMASSLQDPYIHFIGEEYEQLYVET
FT                   VHTLQLYPEDNRISGPAIRVSYSPLHGTGVAMIPRVLRDWNFPMVNLVEKQAIPDGDFP
FT                   TVHLPNPEDPEALTLGIEQMLRNQDDIFIATDPDADRLGVVCLHENQPYRFNGNQIACL
FT                   LADHILRALSARAPLGKEDKVVKSLVTTEMLSAIVKFYGGDIVNVGTGFKYIGEKIEAW
FT                   RESVVRYIFGAEESYGYLYGTHVEDKDAMSTSALITEAALHQKLQGKTLRDAILDLYET
FT                   HGYFMNKTLSLSFEQGQESLMKSHIEKLAKLDPSTMSLRGYSIHTCENYDQGTGINIPC
FT                   GITYKLPLPKMAMLCYYYQNGGKIIVRPSGTEPKIKLYFELVNHYEVITGNKKEQRQRE
FT                   EESREQLEKFIAEFKEKFFSIESEE"
     atgcagcatc ttcagaagaa aatagaagct ctttgtagcc ccattacaac aaagaatatc        60
     cttacctggt tatctaacga ttgtaatgaa caagataagg ataccatagc tgagcttcta       120
     aacaatgatc caaaacgtct tgaagagcta ttcggaatga ctctttcctt tggtacaggt       180
     gggctgcgga gccctatggg attaggcacc aatagaatca atgtttttac tataagacgt       240
     gcgacccagg gattggctca agtattaaaa aaacatcatc cccattctgg agatctcatt       300
     cgcgtcgttg taggctatga tacgcgccat aattctttcg attttgccca agagactgct       360
     aaggttctag caggaaataa cattcacgtt ctcctattta aacaccctga acctttggct       420
     cttgtctctt tcactttaag agcagaacgc gctttggcag gagtcatgat taccgcttct       480
     cataatcctc cagagtataa cgggtataaa gtgtacatgg catcgggagg ccaggtgctc       540
     cccccttggg atcaggaaat catgcacgcc tcagcacata tagaagagat cgccatggct       600
     agctcattac aagatcccta tattcatttt ataggggagg aatatgagca gctctatgtc       660
     gaaactgtac atacactgca gctctatccc gaagataatc ggatttctgg accagcaatc       720
     cgtgtcagct attctccact acacggaaca ggagtcgcca tgattcctcg agtgttacga       780
     gattggaatt ttcctatggt caaccttgtc gaaaaacagg cgattcctga tggcgatttc       840
     cctacagtac acttgcccaa ccctgaagat cctgaagcac tcactttagg tattgagcaa       900
     atgctaagaa atcaagacga tatttttatc gctaccgacc cggatgcaga ccggttagga       960
     gtggtgtgtc tgcatgagaa tcaaccctat agatttaacg gaaatcaaat agcctgtttg      1020
     cttgcagatc atattttacg tgctttgtct gcgcgcgctc ctctaggaaa ggaggataaa      1080
     gtagtgaaaa gtttagtcac tacagagatg ctctccgcca tcgtaaaatt ttatggcggc      1140
     gatatcgtga atgtagggac aggatttaaa tatatcggtg agaaaataga agcttggcga      1200
     gagagtgtag taagatacat atttggtgcc gaagaatctt acggctacct atacggcaca      1260
     catgtagaag ataaagatgc aatgagtaca tcagcattaa ttacagaggc ggctttgcat      1320
     cagaagctcc aaggaaaaac tcttcgcgat gcgattttag acttatatga aacccatgga      1380
     tatttcatga ataaaacact ttcgttgtcc tttgaacaag gacaagaaag tctcatgaag      1440
     tctcatatag aaaagttggc aaagctcgat ccttccacca tgtccttaag aggctattcc      1500
     attcacacgt gtgaaaatta tgatcaaggg acaggaatca atattccctg cgggatcacg      1560
     tacaaattgc ctctccctaa gatggccatg ttgtgttatt actatcaaaa tggaggaaaa      1620
     attatcgtgc gtccttcagg aacagaaccg aaaatcaaac tctattttga gcttgtcaat      1680
     cattacgaag tcatcacagg aaacaaaaaa gaacaaagac aacgagaaga ggaaagcagg      1740
     gaacaattag agaaattcat tgctgaattt aaagagaaat ttttctccat agagtcggaa      1800
     gaataa                                                                 1806
//

If you have problems or comments...

PBIL Back to PBIL home page