(data stored in SCRATCH zone)

EMBL: CR848038.PE33

CR848038.PE33        Location/Qualifiers
FT   CDS_pept        42611..42865
FT                   /transl_table=11
FT                   /locus_tag="CAB033"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlamydia trachomatis protein Ct666
FT                   SWALL:Y666_CHLTR (SWALL:O84673) (83 aa) fasta scores: E():
FT                   1e-28, 94.04% id in 84 aa. Only significant full-length
FT                   database matches are to predicted Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB033"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63491"
FT                   /db_xref="InterPro:IPR035365"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L777"
FT                   /protein_id="CAH63491.1"
FT                   /translation="MSSGSSCSAFNFNDMLNGVCKYVQGVQQYLTELETSTQGTVDLGT
FT                   MFNLQFRMQILSQYMEAVSNILTAVNTEMITMARAVKGS"
     atgagtagtg gtagcagttg ctcagctttt aattttaatg acatgcttaa tggcgtatgt        60
     aaatacgtcc aaggtgtgca acaatatcta acggaattag aaacctcaac gcaaggtaca       120
     gtcgacttgg gtacgatgtt taatttgcaa ttccgtatgc aaattttatc acagtatatg       180
     gaagctgtat ccaacatctt gacagcagtg aacacagaga tgatcactat ggcaagagct       240
     gttaaaggaa gttaa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page