(data stored in SCRATCH zone)

EMBL: CR848038.PE335

CR848038.PE335       Location/Qualifiers
FT   CDS_pept        complement(397162..397776)
FT                   /transl_table=11
FT                   /locus_tag="CAB343"
FT                   /product="putative inner membrane protein"
FT                   /note="Similar in parts to Chlamydia pneumoniae
FT                   hypothetical protein cpn0440/cp0313/cpj0440 cpn0440 or
FT                   cp0313 or cpj0440 SWALL:Y440_CHLPN (SWALL:Q9Z8A3) (212 aa)
FT                   fasta scores: E(): 2.4e-13, 32.4% id in 179 aa. Note the
FT                   alternative possible translational start site at codon 6"
FT                   /db_xref="EnsemblGenomes-Gn:CAB343"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63793"
FT                   /db_xref="GOA:Q5L6D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6D3"
FT                   /protein_id="CAH63793.1"
FT                   /translation="MIFIVMILLPTASENKTVLLLPWDNYRTSLILRTTVCFTIAVLTC
FT                   LGSIALMSYAIIQGNWLFFGMSLGIILMLISVALILDLPVKNKCFGTTLTNEISQDISN
FT                   VGVESVEKFRVAFANIRNTCIPNMRDLHNKLLNDYDTVISTKEDQIRNLSSSLDALVQD
FT                   KQQELASWIEKHPHAYQTQTLREQLNRWHWHSYEQQSTPVH"
     ttgattttca ttgtcatgat actcttgccc acagcttcag aaaataaaac tgttcttctc        60
     cttccctggg ataattatcg cacgagtctc atactacgta ctacagtctg ttttactatc       120
     gccgtcctca catgtttagg atcgattgct ttgatgagct atgccatcat ccagggaaat       180
     tggttatttt ttggaatgag cttaggcatc attctcatgc tcatttccgt tgctcttatt       240
     ttggatttac cggtgaaaaa taagtgtttt ggaactacat taaccaacga aatttctcaa       300
     gacatatcga atgtaggtgt agaatctgtt gaaaagtttc gtgttgcgtt cgcgaatata       360
     cgcaatacgt gtattcccaa tatgcgagat ttgcataaca agctattaaa cgactatgat       420
     acggttatct ctacaaaaga agatcaaatt cgtaatctct ctagcagtct ggatgccctg       480
     gtgcaggata aacagcagga gttagcaagc tggatagaaa aacatcccca tgcttatcaa       540
     acccaaacat tacgagagca gttaaatcgt tggcattggc attcttacga acaacaaagt       600
     accccggtac actaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page