(data stored in SCRATCH zone)

EMBL: CR848038.PE336

CR848038.PE336       Location/Qualifiers
FT   CDS_pept        complement(397773..398390)
FT                   /transl_table=11
FT                   /locus_tag="CAB344"
FT                   /product="putative inner membrane protein"
FT                   /note="Similar in parts to Chlamydia pneumoniae
FT                   hypothetical protein cpn0439 cpn0439 or cpj0439 or cp0314
FT                   SWALL:Q9Z8A4 (EMBL:AE001627) (175 aa) fasta scores: E():
FT                   2.5e-09, 28.14% id in 167 aa. Note the alternative possible
FT                   translational start site at codon 5"
FT                   /db_xref="EnsemblGenomes-Gn:CAB344"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63794"
FT                   /db_xref="GOA:Q5L6D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6D2"
FT                   /protein_id="CAH63794.1"
FT                   /translation="MLNKMNTFFRFCYYILRNSVVLSLSNSIPATLLSLPNQNSLLFNA
FT                   ERDATVLQKKVAIFIEQSSSSYILAIILLLGTMIAGSVVVAFGCLSLSLPEMIGGVTVI
FT                   VASLVCILLLISMIYLIKCLPSKVQQTITLVNNKTSSLSSFQLLQNAYAKLIYSIIDKE
FT                   QRIERLKQEEYRLLLRLQKWQEIAHATPGMPSSPSNNHNFIS"
     gtgttgaata aaatgaatac tttctttaga ttttgctact acattttaag gaattctgtg        60
     gtattaagtc tttctaattc tattcccgca acacttctct ctttacccaa ccaaaattct       120
     cttcttttca atgcggaaag agatgcgact gtcttacaaa aaaaagttgc tattttcatt       180
     gagcaaagct cttcgtctta tattttagct attatacttt tgcttggcac catgatagcg       240
     ggaagtgtgg ttgtggcttt tggctgtctt tccttaagtc ttcctgaaat gattggcggg       300
     gtgactgtga tagtggcgtc cttagtctgt atacttttac tcattagcat gatttatctg       360
     atcaagtgtt taccgtcgaa agtacaacaa acaatcacgc tcgtgaataa caaaacgtcg       420
     tcgctttctt cttttcagct acttcaaaac gcctatgcaa aactgattta ctcaattata       480
     gataaggaac aacgcataga acggctaaaa caagaagagt accgcttact actcagattg       540
     caaaaatggc aagaaattgc tcatgcaact ccgggaatgc cttcttcacc atcgaataac       600
     cataatttca tcagttga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page