(data stored in SCRATCH zone)

EMBL: CR848038.PE340

CR848038.PE340       Location/Qualifiers
FT   CDS_pept        402923..404353
FT                   /transl_table=11
FT                   /locus_tag="CAB348"
FT                   /product="exported protein"
FT                   /note="Similar to Chlamydia pneumoniae phospholipase D
FT                   superfamily cpn0435 or cpj0435 or cp0318 SWALL:Q9Z8A8
FT                   (EMBL:AE001626) (476 aa) fasta scores: E(): 5.1e-104,
FT                   51.68% id in 476 aa> Also similar in the C-terminus to
FT                   several others e.g. Clostridium perfringens cardiolipin
FT                   synthetase Cls or ClsD or cpe1430 SWALL:CLS_CLOPE
FT                   (SWALL:Q9ZNC6) (476 aa) fasta scores: E(): 0.0027, 26.84%
FT                   id in 190 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB348"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63798"
FT                   /db_xref="GOA:Q5L6C8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6C8"
FT                   /protein_id="CAH63798.1"
FT                   /translation="MFMNKTRWSLVIAFFFVFIAKDAAAFMVHFPESKESVGVVIHDNS
FT                   VEVYESVLSAIDVANHYIELSPCMAGGNLLKEIVEHIDARMDLIPGLRAYLLIQPTFID
FT                   SEDKIVLEGIKSRWPNRFFYLFTGCPPGPSILSPNVIESHVKISIIDGKYIFMGGTNFE
FT                   DFMCTRGDTIPEPVESPRLVIGGIHRPLAFRDQDITVSSARLGTELRKEFHAHYALWRT
FT                   YAERPWFNKNLDDFRALPFPQLSVEEAQATYCPKIEENSDLVSTDLKNIRVIFSGPDES
FT                   KNAITQGYVDLIDNAKKSIKIANMYFIPNNDILESLRSASFSRKVRTEIITNGSNENSP
FT                   PLTEVYAWGNRMNYFFLSYGERPALWKKFIFSKKQPNSSLRVNEYYVRDTQLHKKCMIV
FT                   DDRVFVIGSYNFGKKSDLFDYEGIILIDSPEVAAKANVVFKKDLSLSKPIENSEIFGWY
FT                   FDPMYNLLGHLQINFMPA"
     ttgtttatga ataaaacgcg atggagctta gttatagcct tcttttttgt atttatcgca        60
     aaagatgctg cggcttttat ggtgcatttt cctgaatcga aagaatctgt gggtgtggtt       120
     attcatgata acagtgtgga agtttatgaa agtgttttat ctgctataga tgttgctaat       180
     cattatattg aattatctcc ttgtatggca ggaggaaacc tattaaaaga gatagtcgag       240
     catatagatg cacgtatgga tctcattcct ggactacgcg cctatcttct tatccaaccc       300
     acattcattg atagcgagga taagattgtt cttgagggga taaaatcgcg ttggcctaac       360
     cgtttttttt acttatttac aggatgtcct cctggtccca gcatcctttc tcctaatgtt       420
     atagaaagtc atgtgaagat ttccatcatc gatggcaagt atatctttat gggagggaca       480
     aattttgaag attttatgtg tacccgaggg gatactattc ctgaacctgt agagtctcct       540
     cggctggtta tcgggggaat tcacagaccg ctagcatttc gcgaccagga tattaccgtg       600
     agttctgcac gactcggtac cgagttaaga aaggaatttc atgcgcatta tgcactgtgg       660
     cgtacatatg cggagaggcc ctggtttaat aaaaatctcg atgattttcg cgctcttcct       720
     tttccacagc tgtctgtaga agaagctcaa gccacgtatt gtcctaaaat cgaagaaaac       780
     tcagatctcg tatctacaga tttgaaaaac attcgtgtga ttttttcagg accggatgag       840
     agtaaaaacg cgattactca aggctacgta gatttaatag ataacgcaaa gaagtccata       900
     aaaattgcca atatgtactt cattcctaac aacgacattc ttgagagttt gagatcagcg       960
     tcttttagcc gtaaagtacg taccgaaatt attacgaatg gatccaatga aaatagtccc      1020
     ccacttacag aagtctatgc ttggggaaat cgtatgaact atttctttct atcttatggt      1080
     gaacgcccgg cactatggaa aaagttcatt ttttctaaaa aacagccgaa ttcttcccta      1140
     cgcgtaaatg aatattacgt tcgcgataca cagttacata agaaatgtat gattgtagat      1200
     gatcgtgtgt ttgtcatcgg tagctacaat tttggaaaga aaagtgacct ttttgattat      1260
     gaaggtatca tattaattga ttctccagag gttgctgcta aagccaatgt cgtctttaag      1320
     aaagatttga gcttatccaa acctatagag aattctgaaa tttttggttg gtatttcgat      1380
     ccgatgtata atcttcttgg tcatttacag attaatttta tgccggcgta a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page