(data stored in SCRATCH zone)

EMBL: CR848038.PE351

CR848038.PE351       Location/Qualifiers
FT   CDS_pept        complement(412801..414153)
FT                   /transl_table=11
FT                   /locus_tag="CAB358"
FT                   /product="chromosomal replication initiator protein"
FT                   /note="Similar to Bacillus subtilis chromosomal replication
FT                   initiator protein DnaA or DnaH SWALL:DNAA_BACSU
FT                   (SWALL:P05648) (446 aa) fasta scores: E(): 3.3e-57, 36.11%
FT                   id in 443 aa and to Listeria innocua chromosomal
FT                   replication initiator protein DnaA or lin0001
FT                   SWALL:DNAA_LISIN (SWALL:Q92FV2) (451 aa) fasta scores: E():
FT                   2.8e-55, 36.77% id in 446 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB358"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63809"
FT                   /db_xref="GOA:Q5L6B8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6B8"
FT                   /protein_id="CAH63809.1"
FT                   /translation="MLTCSDCSTWEQFVNYVKTRCSKTAFENWISPIQIIEETQEKIRL
FT                   EVPNIFVQNYLLDNYKQDLCSFVPLDAQGEPALEFVVAEIKKAPPQPVAPREQQETPIE
FT                   TFEESKDFELKLNTAYRFDNFIEGPSNQFVKSAAVGIAGRPGRSYNPLFIHGGVGLGKT
FT                   HLLHAVGHYVREHHKNLRVHCITTEAFINDLVQHLRLKSIDKMKNFYRSLDLLLVDDIQ
FT                   FLQNRQNFEEEFCNTFETLINLNKQIVITSDKPPGQLKLSERIIARMEWGLVAHVGIPD
FT                   LETRVAILQHKAEQKGLHIPNEIAFYIADHIYGNVRQLEGAINKLTAYCRLFGKTLTET
FT                   IVRDTLKELFRSPSKQKVSVESILKSVATVFQVKLQELKGNSRSKELVLARQVAMYLAK
FT                   TLITDSLVAIGSAFGKTHSTVLYACKTIEQKIEKDETLTRQISLCKNHIVG"
     atgttaacct gtagcgattg tagtacttgg gaacagtttg tgaattatgt caagacacgt        60
     tgctctaaaa cggcttttga aaactggatt tctcctattc aaattataga agaaacccag       120
     gaaaagatcc gtttagaagt tcccaatatc tttgttcaaa actaccttct tgataattat       180
     aaacaagacc tgtgttcttt cgttcctctt gatgctcaag gggagccagc tttagagttt       240
     gttgttgcgg aaattaaaaa agcccctccg caacccgtag cccctcgaga gcagcaagaa       300
     acccctatag aaacttttga agaatccaaa gacttcgaac taaagttaaa cacggcttat       360
     cgttttgata atttcataga aggcccttca aaccaatttg tgaaatccgc agctgtaggt       420
     attgctggcc gtcccgggcg ttcgtataat cctctgttca ttcatggagg cgtaggccta       480
     ggaaaaacac atcttctcca tgctgtaggt cactatgtca gagagcatca caaaaacctt       540
     cgtgttcact gtatcaccac tgaagctttc attaatgatc tcgtgcaaca tctcagattg       600
     aaatcaattg ataaaatgaa aaatttttat cgttcgttag atctacttct tgtcgatgat       660
     atccagtttt tgcaaaacag acaaaatttc gaagaagaat tttgcaatac ctttgagaca       720
     ttaattaact taaataaaca aattgtcatt actagtgata agcctccagg acaattaaaa       780
     ctttccgaac gtatcattgc tagaatggaa tgggggttag ttgctcacgt aggcatccca       840
     gatttagaaa cacgggtagc cattttacaa cataaagcag aacagaaagg cttacatatt       900
     cctaatgaaa tagcctttta catcgcagat catatctatg gaaatgtacg ccaactagaa       960
     ggcgctatta ataaacttac tgcttattgc cgcttatttg gaaaaacact taccgaaact      1020
     attgtccgcg acacgttaaa agaacttttt cgctcccctt ctaaacaaaa agtttctgta      1080
     gaaagcatat taaaaagtgt ggctacagtc tttcaagtca agctccaaga gcttaaagga      1140
     aactctcgtt ctaaagaact cgttttggca cgtcaagtgg ctatgtacct ggcaaaaaca      1200
     cttatcacag attctttagt tgctataggt tctgcttttg gaaaaacaca ttctacagta      1260
     ctttatgctt gcaaaactat agaacaaaaa atagaaaaag atgaaactct aacgcgtcaa      1320
     attagtttat gtaaaaacca tattgttggg taa                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page