(data stored in SCRATCH zone)

EMBL: CR848038.PE356

CR848038.PE356       Location/Qualifiers
FT   CDS_pept        416667..418616
FT                   /transl_table=11
FT                   /locus_tag="CAB362"
FT                   /product="probable penicillin-binding protein"
FT                   /note="Similar to Neisseria meningitidis penicillin-binding
FT                   protein 2 PenA or Nma2072 or Nmb0413 SWALL:PBP2_NEIMA
FT                   (SWALL:P11882) (581 aa) fasta scores: E(): 1.1e-11, 28.75%
FT                   id in 546 aa, and to Buchnera aphidicola peptidoglycan
FT                   synthetase FtsI or bu222 SWALL:FTSI_BUCAI (SWALL:P57317)
FT                   (579 aa) fasta scores: E(): 2e-10, 26.57% id in 621 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB362"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63814"
FT                   /db_xref="GOA:Q5L6B3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6B3"
FT                   /protein_id="CAH63814.1"
FT                   /translation="MNHRKCLTMITYGVLLSYSFLIIRYYKIQICEEKRWAAEALGQHE
FT                   FRVKDPFRRGTFFSQMNLRKGDSEQRQALAVDITKFHLCLDAVAVPEEHRDVIAKKVFS
FT                   LIGEGDYDKLRAEFDKKSRYRKLFLWLDRADHDRILSWWRGYAAKSKIPSNALFFMTDY
FT                   QRSYPFGKLLGQVLHTLREVKDEKTGKAFPTGGLEAYFNHVLEGEPGERKFLRSPLNRL
FT                   DLDKVTKIPRDGSDIYLTVNPCIQTIAEEELEKGVKEAKAKGGRLILMNAYTGEILALA
FT                   QYPFFNPSEYKEFFNDKEKIEHTKVTSVSDVFEPGSIMKPLTLAIALLANEEMVKRSGK
FT                   PLFDPNEPIDVTRRIFPGRKQFPLKDISSNRRLNMYMAIQKSSNVYVAQLADLIVQHLG
FT                   NHWYEDKLLLLGFGKKTGIELPGEASGLVPSPKRFHINGVPEWSLSTPYSLAMGYNILA
FT                   TGVQMVKAYAILANGGYDVRPTLIKKIVTTSGKEYVLHPQVRGERILSQDIVDEVLKAT
FT                   RFTTYPGGTGFRAAPKKHSSAGKTGTTEKLVHGKYDKHRHISSFIGITPIYPSAGGSVP
FT                   LVMLVSIDDPDHCVREDGTKNYMGGRCAAPVFGRVADRVLSYLGVPEDKEKYSYQSEVA
FT                   AMKALYEEWNRSGK"
     atgaatcacc gtaaatgctt aaccatgatt acctatggag ttctgctctc ctattctttc        60
     ctgatcatac ggtattataa aattcagatt tgtgaggaga aacgttgggc agcagaagct       120
     ttaggacaac atgaatttcg agtaaaggac ccttttcgta gggggacgtt tttttctcag       180
     atgaatttac gtaagggaga ttcagagcaa cgacaagctc tggccgtgga cattacgaaa       240
     tttcatcttt gtttagatgc tgtagctgtt cctgaagaac accgtgatgt gattgctaag       300
     aaagttttta gtctcattgg agaaggtgat tatgacaaac tccgtgcgga gtttgataaa       360
     aaatctcgct atcgaaagtt atttctttgg ttagatcgtg cggatcatga ccgcatccta       420
     tcttggtggc gggggtacgc agcaaaatct aaaataccct cgaatgcttt gtttttcatg       480
     accgactatc aaagatctta tccctttggc aaacttttag gccaagttct acatactctg       540
     agagaagtca aggatgagaa aacaggcaaa gctttcccta caggaggttt agaagcctat       600
     tttaaccacg tccttgaagg agagccagga gaacggaaat tcctacgttc tcctttaaat       660
     cgtttagatc tagataaagt cacaaagatt cctagggatg gttcggatat ttatctcaca       720
     gtcaatccct gtatacagac tatagcggaa gaggaattag aaaaaggggt aaaggaagcc       780
     aaagctaaag gtgggcgtct aattttaatg aatgcttata caggcgagat tcttgcttta       840
     gcacagtatc ctttctttaa tccttcggaa tacaaggaat ttttcaatga taaggaaaaa       900
     atagagcaca caaaagtaac atcagtcagt gatgtgtttg aacccggctc tatcatgaaa       960
     cctctgactc tggctatagc gttgctggcc aacgaagaga tggtgaaaag atcaggaaag      1020
     cccttatttg atcctaatga acctatagat gtaacccgca ggattttccc aggaagaaag      1080
     caatttccgc ttaaggatat ctcatcgaat cggcgtttaa atatgtacat ggcgattcaa      1140
     aagtcttcga acgtttatgt agcgcaactt gctgatctta tagtgcaaca tctagggaac      1200
     cactggtatg aagacaagtt attgttatta ggatttggta aaaagacggg gatagaattg      1260
     ccaggggaag cgtcaggatt ggtaccttca cctaaacgtt ttcatattaa tggggttcct      1320
     gaatggtctt tatctacgcc ttattctctt gctatggggt ataatatctt ggctacggga      1380
     gtgcagatgg ttaaagccta tgccattctt gccaacggtg gttatgatgt gcgccctacc      1440
     ttgataaaaa aaatagtcac tacttctgga aaagagtacg tgttgcatcc tcaagttcgt      1500
     ggagaaagaa ttctttctca ggacattgtg gatgaggtat tgaaagctac gcgttttact      1560
     acctatcctg gaggaacggg atttcgggct gcgcctaaaa agcattccag tgcagggaaa      1620
     acaggaacaa cagaaaagct agttcatgga aagtatgata agcatcggca tatttcttca      1680
     tttataggta tcacgccgat atacccttcg gcagggggga gtgttccttt ggtcatgctt      1740
     gtctctatag atgatcctga tcattgtgtt cgcgaggatg gaacaaagaa ctatatggga      1800
     ggccgatgtg ccgcccctgt atttggcaga gttgcggatc gtgttttatc ttatctagga      1860
     gttcccgaag ataaagaaaa atacagttat cagagtgagg tggctgctat gaaagctttg      1920
     tatgaggaat ggaatcgttc ggggaaataa                                       1950
//

If you have problems or comments...

PBIL Back to PBIL home page