(data stored in SCRATCH zone)

EMBL: CR848038.PE385

CR848038.PE385       Location/Qualifiers
FT   CDS_pept        complement(448272..448601)
FT                   /transl_table=11
FT                   /locus_tag="CAB390"
FT                   /product="putative membrane protein"
FT                   /note="Similar to several Chlamydia proteins of undefined
FT                   function including: Chlamydia pneumoniae ct038 hypothetical
FT                   protein cpn0393 or cpj0393 or cp0362 SWALL:Q9Z8F0
FT                   (EMBL:AE001623) (115 aa) fasta scores: E(): 8.7e-20, 50.9%
FT                   id in 110 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB390"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63843"
FT                   /db_xref="GOA:Q5L688"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L688"
FT                   /protein_id="CAH63843.1"
FT                   /translation="MQKVHWQKCLDEIVVNSWWLVLCMLISGFMYDRAIRELKQEESRL
FT                   RKRVSELQEKILCAEEEQKELRLHIQHWDNPVVIESALIRRLGLIPKGYTKICFSPVIE
FT                   SKSTD"
     atgcaaaaag ttcactggca gaaatgcctt gacgaaattg tggttaactc ttggtggtta        60
     gtcctctgca tgcttattag tgggtttatg tatgatcgtg ctattcgtga gttaaaacaa       120
     gaagagagtc gattacgaaa acgtgtatcg gaacttcaag aaaaaattct ttgtgctgaa       180
     gaagaacaaa aagagcttcg actgcatatt caacactggg ataatcctgt agtgattgag       240
     tctgctttga ttcgtagatt aggcttgatt cctaagggtt atactaaaat atgtttttct       300
     ccggttatag aatcgaagag tacagattga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page