(data stored in SCRATCH zone)

EMBL: CR848038.PE388

CR848038.PE388       Location/Qualifiers
FT   CDS_pept        450798..451613
FT                   /transl_table=11
FT                   /locus_tag="CAB393"
FT                   /product="putative exported protein"
FT                   /note="Similar to several Chlamydia proteins of undefined
FT                   function including: Chlamydia pneumoniae hypothetical
FT                   protein cpn0389/cp0366/cpj0389 cpn0389 or cp0366 or cpj0389
FT                   SWALL:Y389_CHLPN (SWALL:Q9Z8F4) (272 aa) fasta scores: E():
FT                   3.4e-84, 72.18% id in 266 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB393"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63846"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L685"
FT                   /protein_id="CAH63846.1"
FT                   /translation="MKILKYILLGLSFSMGVAGYTEVKVSDTFTVQPIVSEPKIRVLLL
FT                   NESTTALIEAKGPYRLYGDNTLLQHSPHGLRCAAHALYGGVRWGENFPGVQCLKIEPID
FT                   DSASLFVNGLQYKGALYIHKTDKHCILVTNELTVEEYLKSILSTKYLKELDKEALSACV
FT                   ILERTALYERLLAKNPQDFWHVTGDEDNYCGYGATKQFYGVEDAVDWTSRLIVDNPEGL
FT                   IIDADGLLKANVDRLAVEGYNARQILEKFYKNADFVVIESWNDEANEIS"
     gtgaagatat tgaagtacat ccttttggga ctttccttca gtatgggtgt agccgggtac        60
     acagaagtta aggtttctga tacgtttacg gtgcaaccta ttgtttctga acctaaaatc       120
     cgggttcttc ttctgaatga aagtacaaca gccttgatag aagctaaagg tccttatcgt       180
     ctttatggcg ataatacatt gttacaacac tcaccgcatg gtttgcgttg cgcagctcat       240
     gcactttatg gaggagtgcg ttggggagaa aacttccctg gagtgcaatg tttgaaaata       300
     gaacctatcg atgattcggc ctcattattt gtcaacggac tacagtacaa aggggctcta       360
     tacatccata agacggataa gcattgtatt cttgtcacta acgagcttac cgtcgaagag       420
     tatcttaaat ccattctttc tacaaaatat ctcaaggaat tagataaaga agctttgtcc       480
     gcatgcgtga ttttagagag aacagcttta tatgaaaggc tgctcgctaa aaatcctcag       540
     gatttctggc atgtgacagg agatgaagac aattattgtg gttacggagc taccaaacaa       600
     ttctacggtg ttgaagatgc tgtagattgg acgtcacgct tgattgtgga taatcctgaa       660
     ggattaatca ttgatgctga tggtttgctt aaagctaatg tcgatcgtct tgctgtagaa       720
     ggctataatg cacgtcaaat ccttgaaaaa ttctataaaa atgccgattt tgtagttata       780
     gaatcctgga atgatgaagc taatgaaatt agctaa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page