(data stored in SCRATCH zone)

EMBL: CR848038.PE397

CR848038.PE397       Location/Qualifiers
FT   CDS_pept        459997..461358
FT                   /transl_table=11
FT                   /locus_tag="CAB402"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to several Prokaryotic and Eukaryotic
FT                   proteins including: Chlamydia trachomatis hypothetical
FT                   protein Ct049 SWALL:O84052 (EMBL:AE001279) (490 aa) fasta
FT                   scores: E(): 2.1e-15, 30.13% id in 521 aa, and to
FT                   Matricaria chamomilla thiol protease SWALL:Q9SP93
FT                   (EMBL:AF182079) (501 aa) fasta scores: E(): 1.2, 21.01% id
FT                   in 395 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB402"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63855"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L676"
FT                   /protein_id="CAH63855.1"
FT                   /translation="MKNIIKNINTQYSSATTSEESNETPSNENEVVENHNAIPDEKILF
FT                   SCVHGDSTSKHVTRQPWNVSNHRITNIVRGDSDSAPEGSIALKSDLSDYLQKGDITTTG
FT                   IFLRDTGGLMIGDIDMGSAYTVLGLPTSYKNTIVGSADAASVGMVEEDIGTLAHKVTDL
FT                   ISRINQLVSENGLDKIIKDLGTPTLGGSGKPPNVTLTKPKEAKWLVRDGGNSMQGDLGF
FT                   QKSEQSSPTAPEPTITNLPISDNPKNKTAAALGAISTGTPKDDLQRMVAVDDIIKTVES
FT                   VKTNNNAYPNWSGMDIPCVCLKQGAPNGSSSGNYDKSKNSELYIQTKDGNSVTLLRRGI
FT                   YCVSFCYDFTQPEPPAPPSPPTPPVSPDPSAPPRTPDAKSAEVSCTLSLKPKEGEKKEC
FT                   YKVTGKASSSLIGKTYIFVPGDQASVSIDLSFDVSSSPAVDKRTWTITFIGAAY"
     atgaaaaata taattaaaaa tataaatacg cagtattcta gtgctaccac ttctgaggaa        60
     tcaaacgaaa ctcccagtaa tgagaatgag gttgttgaaa atcataacgc gattcccgat       120
     gagaagattc tattttcttg tgttcatggt gatagcacaa gtaagcatgt cacgcgtcaa       180
     ccatggaacg tttccaatca cagaattacc aacatcgtca gaggtgatag tgactcagcc       240
     cctgagggga gtattgcttt aaaaagtgat ctcagtgatt acctgcaaaa aggagacatc       300
     actaccacgg gaatcttttt aagagacacc ggtggattaa tgatcggtga tattgacatg       360
     ggatctgctt acactgtatt gggtctacct acttcctata aaaacacgat cgtaggttct       420
     gcggatgcag cgtctgttgg tatggtagag gaggatatag gtactcttgc tcacaaggtc       480
     accgatctga ttagtcgtat taatcaactc gtatctgaaa atggtttgga taaaattatt       540
     aaagacctag gcacaccgac tcttggcggg tctggaaaac cgcctaatgt caccctgaca       600
     aaacccaagg aggctaaatg gttagtgcgt gatggtggga attctatgca gggagatttg       660
     ggatttcaaa aaagtgaaca aagctcacca acggccccag aaccaaccat taccaatctt       720
     ccgatatcag acaatccaaa aaataaaaca gcggctgccc taggagcgat ttctacaggt       780
     actccgaagg atgatctgca aagaatggtt gctgtagatg atataatcaa aacggtggag       840
     agtgtaaaaa ctaacaataa tgcgtatccg aattggtcgg gcatggacat cccatgtgtc       900
     tgtttaaaac agggtgctcc caatggatcg tcatccggaa attatgataa atctaaaaat       960
     tctgagttat acatccagac taaagatgga aatagcgtga cgctattgcg tagaggcatc      1020
     tactgtgttt ctttttgcta tgactttact cagccagaac ctccagcccc tccttctcct      1080
     cccacgcctc ctgtttctcc agatccttct gctcctccta ggactcctga tgctaaatcc      1140
     gcagaggtca gttgcacatt atcccttaaa cctaaagaag gggagaaaaa agagtgttat      1200
     aaagtgacgg ggaaagcgag ctctagtttg ataggaaaga cttatatttt tgttcctggt      1260
     gatcaagcat cagtatccat agatttaagt tttgatgttt catctagtcc agccgttgac      1320
     aaacgtactt ggacgataac ttttataggc gctgcttatt aa                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page