(data stored in SCRATCH zone)

EMBL: CR848038.PE403

CR848038.PE403       Location/Qualifiers
FT   CDS_pept        complement(468404..469147)
FT                   /transl_table=11
FT                   /locus_tag="CAB408"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to several proteins of undefined function
FT                   including: Chlamydia trachomatis hypothetical protein Ct056
FT                   SWALL:O84059 (EMBL:AE001280) (243 aa) fasta scores: E():
FT                   3.2e-56, 60.97% id in 246 aa, and to Brucella melitensis
FT                   hypothetical cytosolic protein Bmei0486 bmei0486
FT                   SWALL:Q8YIF8 (EMBL:AE009491) (265 aa) fasta scores: E():
FT                   1.9e-12, 28.06% id in 196 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB408"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63861"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L670"
FT                   /protein_id="CAH63861.1"
FT                   /translation="MAQSTPSDNNLTKLTFPELSDLPLRHGLFPKQTDAEGYVYVPKND
FT                   EIRKSLGAERFCDLHQVHSTSLRHATYTTPSGCPADGLYTHDPMLSLHIRHSDCQPAIF
FT                   YDPENHVVANVHCGWRGLVGNIYAVTVATLKRVYNSRPQDLIVVIGPSLGPDYAIYPDY
FT                   RELFPPSFFAFMPEANHLDFRAIARKQLLDLGISSSKITISERCTYTEHEIFFSSRYRN
FT                   YYSEPNVIDTPIKKNNVTAVLLLPR"
     atggcacaat caactccctc agataataac ctaactaagc ttactttccc agaactctct        60
     gacctccccc tacgtcatgg attgttccct aaacaaacag atgcagaagg ttacgtctat       120
     gtgcctaaaa atgatgagat ccgtaaatct ctaggtgctg aacgtttttg tgatctccat       180
     caagtgcata gcacaagttt acgtcatgcg acatatacca ccccttcagg gtgccctgct       240
     gacggattgt atactcatga tcccatgctt tctctgcaca tccgacattc tgattgccaa       300
     ccggcaattt tctatgatcc cgaaaatcat gttgttgcga atgttcactg tggatggcga       360
     ggacttgttg gaaatatcta cgcggtaact gtagctacat taaaacgtgt atataactcc       420
     cgtccgcaag atttaattgt tgttatcggt ccttctctag gcccggatta cgctatttat       480
     cccgattata gagagctttt tcctccgagc ttttttgcct tcatgcccga ggcaaaccat       540
     ttggacttcc gtgcgatagc gagaaaacag ttgctggacc tgggaatctc aagttctaaa       600
     attacgattt ctgaaagatg cacctatacc gaacatgaga ttttcttctc ttctcggtac       660
     cgcaactact attcagaacc taacgtgata gatacaccta taaaaaagaa caacgtcact       720
     gctgttctgc ttcttcctag atga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page