(data stored in SCRATCH zone)

EMBL: CR848038.PE415

CR848038.PE415       Location/Qualifiers
FT   CDS_pept        483905..485212
FT                   /transl_table=11
FT                   /locus_tag="CAB420"
FT                   /product="putative inner membrane protein"
FT                   /note="Similar to several Chlamydial proteins of undefined
FT                   function including: Chlamydophila caviae hypothetical
FT                   protein cca00434 SWALL:Q823H6 (EMBL:AE016995) (451 aa)
FT                   fasta scores: E(): 1.6e-99, 58.39% id in 423 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB420"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63873"
FT                   /db_xref="GOA:Q5L658"
FT                   /db_xref="InterPro:IPR010792"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L658"
FT                   /protein_id="CAH63873.1"
FT                   /translation="MQASNLFVSQILPKQEVVCRYMQTKRPTPSQIIILIVLSILFIIS
FT                   GLIFLSILPSYVNIIISLLCAGMSWCILSFVTAQIIIKYSQPKYKHIPFGFRYVIKSEF
FT                   PKVFFDLVTKQDLKLTNFRELLVYIHDCRESQETSLRNHRHKLSPQLKKILEDFGVDNL
FT                   DSEINGQHLPSLDNLLIENCPLYWVKRFIELGNKNVLRENLEKYNLGYSGIYWFSELDS
FT                   IRQSVTPRTEHGTIFLMQSYGLAQELRHEEYVFLMDQVKNHTWDHRQVTAVVDRLLINA
FT                   QGDYSRYMGEKDKVELLSELRVTFTEESIKELVFRICSHGISWEQLQLIRSTSLASWQF
FT                   LCWLDQSAPHGGIRILARSFLGDFISENSLRYESNIALATYSECKNVSRYKSLMNQKTS
FT                   QAWKTICYYFNHRMKFHEKFEDIEETYLNRDDEGYN"
     atgcaagctt ctaatctttt tgtctcccaa atacttccaa agcaagaagt agtttgtcga        60
     tacatgcaaa caaagagacc aacgccatct caaataatca tattaattgt tttgagtatt       120
     ttatttatta tttcaggtct tattttttta tcgatattac cttcatatgt aaatatcatt       180
     atctcactac tatgcgcagg tatgagctgg tgtattttat cgtttgttac agcccaaatt       240
     atcattaaat attctcaacc taaatacaag cacatccctt ttggatttcg ttatgtaatt       300
     aaatcggagt ttcctaaggt attttttgat ttagtcacta agcaagactt aaaacttacg       360
     aattttaggg agttattagt ctatattcat gattgtagag aatctcaaga aacatcactt       420
     cgaaatcatc gacataaact ctctcctcag ttaaagaaga ttttggaaga ttttggtgtt       480
     gataatttag acagcgaaat taacggacaa catcttccaa gcttagacaa cttattaata       540
     gaaaattgcc ctttatattg ggtgaagcgc tttatagagt taggtaataa gaatgtctta       600
     agagaaaatt tagaaaaata caacctcggg tattctggaa tctattggtt ttctgaatta       660
     gattcaatac gtcaatctgt tactccaaga acggaacatg gaacaatttt cctcatgcaa       720
     tcttatggat tagcgcaaga attgcgccac gaggaatatg tttttttaat ggatcaggtg       780
     aaaaatcata cttgggatca tcgacaagta accgctgtag tagacaggtt attaattaat       840
     gctcaaggag attatagcag atatatgggt gagaaagata aggtagagct attgtcagaa       900
     ctacgggtga catttacaga ggagagtata aaagagctcg tttttcgtat atgttcacat       960
     ggtatctctt gggagcaact acagcttatt cgatcaacat cgcttgcttc ttggcagttt      1020
     ttatgttggt tagatcaatc ggctccccac ggaggtatac gcatactagc aaggtctttt      1080
     ctaggagatt ttattagtga gaatagtctt aggtatgagt ctaatattgc tttagcaact      1140
     tattctgaat gtaaaaatgt ttcccgatac aaaagcctga tgaatcaaaa aacaagtcaa      1200
     gcttggaaga ctatatgcta ctattttaat caccgtatga aattccatga aaaattcgaa      1260
     gatatagaag aaacttatct aaatagggat gacgaaggtt ataattaa                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page